CAZyme Information: MGYG000003018_00382

Basic Information

• Species: Alistipes_A sp900549685
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes_A; Alistipes_A sp900549685
• CAZyme ID: MGYG000003018_00382
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
925	MGYG000003018_15|CGC1	103650.89	4.7112

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003018	2600623	MAG	China	Asia

• Gene Location: Start: 4158; End: 6935 Strand: +

Full Sequence      

MMKKLNLWAFVLAAALLSCEDKNTGVVDLTTEMRENPVGLDELRPRLSWKLRSAKSDAMQ
TGYRIWVATDKNALQKGENLLWDSGDVSSDRSAFVEYDGPALESRGRYFWKVRVATDKGD
TLWSAPAQWSMALLDEGDWQAQWIGMDSSLNASDRLAGDSRLAARYLRKEFEVGNKVDRA
VLYISGLGFYECYINGVKINEDVFAPTATDYSTNVAYNVFDVTRFLKDKDNTIGVILGNG
RYFSMRLPAEGIGHGEGTIRQFGFPKLLAQLELTYQDGTSQVVSSDASWKLSTDGPIIAN
NEFDGEEYDARLEMKGWAANGFDDSGWHAVQLVAAPEGKLHAQRNPNIRTMDTVDPVSVT
RLNDSVHIVDMGQNLVGWLAVTLKGEKDKPIRMRFAETLKDDGSLYMDNLRGARVTDIYT
PASDGVFSWEPRFTYHGFRFVEITGLNYTPDLRSFQGKVNYDEMKTKGWIETSDETLNTV
FRNAYWGIRGNYRSMPTDCPQRDERMGWLGDRAMGCIGESYLFDHALLYEKWLRDIEAMQ
SEDGNVPDVAPAFWSFDQHSGNVTWPAAYICVADMLYRQYGDLRPVERHYASMKKWIEFI
RDTRMKDDIVICDVYGDWCMPPESPELIWSQDPARVTDGRLLGTSFYYRLLHTMARFAAL
TGNEADAADFLAQAARIKEAYNKMFLHADEGLYANNTVTANMISLMQGLVPDSLAGRVFA
NVVEKTKGEFDSHVSTGLIGIQFLMRGLTQYGAGDLAYTIATNRTYPSWGYMADKGATTI
WELWNGDTADPAMNSGNHVMLLGDLIIWYYENLAGIRSDAEQAGFKKIVMEPYFPEGLDW
VKASTESMYGRIVSEWSKTDNGLVWKIEVPANTTASVRIPAAAVEQVTEGGVPVLQNPAV
KSAVAADGFVVLEIGSGKFDFLAAR

Enzyme Prediction     

EC	3.2.1.40	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	359	878	1e-159	0.996031746031746
CBM67	141	337	2.2e-39	0.9715909090909091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	5.04e-131	465	813	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	5.35e-65	176	352	2	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	6.89e-36	360	461	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	6.65e-21	815	892	1	76	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA23325.1	0.0	2	925	1	924
QUT49169.1	0.0	21	921	22	909
CEA16358.1	0.0	16	919	21	907
SCM59085.1	0.0	9	923	9	907
BBD46137.1	0.0	2	919	1	903

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	3.37e-186	28	921	34	939	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	2.62e-143	26	921	6	1028	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.02e-117	32	890	10	857	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	1.51e-149	15	880	22	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	1.06e-142	26	921	6	1028	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	4.06e-142	36	881	42	880	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	3.13e-137	4	922	5	948	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000045	0.043336	0.956577	0.000016	0.000022	0.000018

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003018_00382.