CAZyme Information: MGYG000003018_00769

Basic Information

• Species: Alistipes_A sp900549685
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes_A; Alistipes_A sp900549685
• CAZyme ID: MGYG000003018_00769
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
780		88067.76	7.0773

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003018	2600623	MAG	China	Asia

• Gene Location: Start: 3074; End: 5416 Strand: -

Full Sequence      

MKKSFLSLLTALLVFAATAPSCASVRDDEAQVRWKARWISSGATREKPNTWLNYRKTVDL
PSLPTSVKAKIGADSKYWLWINGRLVVFEGGLKRGPNPNDTYYDEVELAPYLVRGKNTIA
VLLWYFGRPSFAHNDSGKAGLIFDCQTSDFDILSDDTWKCEANAAYGTCPPPMPNMRLAE
SNILYDGRKKNDAWHMPGYDDSYMPQAVENGPAGSQPWNKLVKRPIPLWRIGELRDYESC
TRSGDSLICKLPYNGHFTPYIRLKTSSAGDTVKIMTDNYLVYNGGDNYLRCEYITREGLQ
EYENKGWFNGHKMYYILPEGAEVEAVKFRETGYDTDFTGTFECSDPLYNKFWGKALRTLY
VTMRDTYMDCPDRERSQWTGDAVNESGEALYVLSESATLLTRKWLHDLAGWQKPDGVIYA
PVPSSNWDKELPGQVMASLGYYGLWNYYLYTGDKQTLEDLYPAVQRYIALWKKGDKGTML
LREGGWNWGDWGTDIDIVPLQNCWYYMMIKGMYNTALTLNKKEDAKKYADEMAALKQAFN
NHFWTGSEYRDPQYKNKTDDRIHALAVVSGLADEDKYEAIRRVLLSEEHASPYMEKYVFE
AFVQMGYGAEGLARHNRRFARMVEDDRFTTLFEGWGIGSEGFGGGSVNHAWSGGGLTIAA
QYICGIRPLEAAYRTVGILPNPSGLSHAKATTVTPVGTVESSFEQSPNVFTLNVRMPLEA
KCVIGTPKAGVREVKIDGSTVWKDGRPVKNKVAKFCKTQPDALHLAFDVKGGSHKLIAVQ

Enzyme Prediction     

No EC number prediction in MGYG000003018_00769.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	258	723	1e-90	0.9583333333333334
CBM67	36	218	5.3e-36	0.9943181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.06e-41	336	654	1	331	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.11e-08	665	735	1	75	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	1.29e-07	412	593	328	514	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam08531	Bac_rhamnosid_N	1.14e-04	77	214	16	158	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam02837	Glyco_hydro_2_N	1.43e-04	20	121	37	131	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA22734.1	0.0	23	780	21	777
QUT89433.1	0.0	34	780	21	764
ALJ59524.1	0.0	34	780	21	764
AGY53286.1	1.52e-280	34	778	26	772
ASB50049.1	8.16e-268	34	780	23	772

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.74e-38	34	741	145	913	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
2OKX_A	7.23e-19	34	227	6	196	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
3CIH_A	8.40e-17	336	699	299	672	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
6GSZ_A	1.08e-12	103	547	184	648	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF03	3.92e-21	34	717	146	869	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KNB2	6.84e-21	34	754	149	908	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
T2KPL4	9.23e-21	54	740	187	920	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001436	0.323859	0.673873	0.000359	0.000242	0.000205

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003018_00769.