CAZyme Information: MGYG000003019_01048

Basic Information

• Species: Alistipes sp900553175
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900553175
• CAZyme ID: MGYG000003019_01048
• CAZy Family: GT94
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	MGYG000003019_32|CGC1	43063.53	8.2208

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003019	1454145	MAG	China	Asia

• Gene Location: Start: 786; End: 1922 Strand: -

Full Sequence      

MKITILGPAHPYRGGLAAIMETMARTFRACGHDADIYTFTRQYPALLFPGRSQTTSAPPP
ADLRIERCVDTMNPLNWWRVGRRLRRERPDFVLLKYWTPFMAPAFGTIARLARRNGHTRV
LCQIDNVEPHEHHFIDKPFNRYFLRSVDGFVYMSEQVHRELSAYTSAPALFSPHPLFENF
GAPVDRAEACARMGLDPSVRYTLFFGLIRDYKGLDLLLDAWAALHRAGAAAGRKLLVAGE
FYTSPEPYLRRIAENGLGDEVILRDRFIPDDEVKYCFSAADFVVLPYRTATQSGVTQIAY
RFSTPMIVTDVGGLPEIVPDGRVGYVCPPTADGVADAIRCIVRPGVLERFRENCAEERKR
FSWEEMCARILELYERMR

Enzyme Prediction     

No EC number prediction in MGYG000003019_01048.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT94	117	309	1.2e-16	0.6254416961130742

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	3.63e-32	2	375	1	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	2.71e-31	1	378	1	378	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03822	GT4_mannosyltransferase-like	4.15e-30	2	375	1	370	mannosyltransferases of glycosyltransferase family 4 and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. ORF704 in E. coli has been shown to be involved in the biosynthesis of O-specific mannose homopolysaccharides.
pfam13692	Glyco_trans_1_4	2.41e-17	203	343	5	137	Glycosyl transferases group 1.
cd03798	GT4_WlbH-like	2.90e-17	106	376	108	375	Bordetella parapertussis WlbH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFL79017.1	1.34e-221	1	378	1	378
CBK64994.1	1.64e-221	1	374	13	386
BBL07853.1	4.97e-217	1	378	1	378
BBL10644.1	4.97e-217	1	378	1	378
BBK99837.1	7.06e-217	1	378	1	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TVP_A	8.05e-08	191	377	205	399	Structureof Mycobacterium smegmatis alpha-maltose-1-phosphate synthase GlgM [Mycolicibacterium smegmatis MC2 155],6TVP_B Structure of Mycobacterium smegmatis alpha-maltose-1-phosphate synthase GlgM [Mycolicibacterium smegmatis MC2 155]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D4GU66	3.96e-16	200	377	194	371	Low-salt glycan biosynthesis hexosyltransferase Agl5 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=agl5 PE=3 SV=1
C7Q4Y6	4.39e-14	154	374	178	407	D-inositol 3-phosphate glycosyltransferase 1 OS=Catenulispora acidiphila (strain DSM 44928 / JCM 14897 / NBRC 102108 / NRRL B-24433 / ID139908) OX=479433 GN=mshA1 PE=3 SV=1
A1SP12	2.20e-12	183	378	243	451	D-inositol 3-phosphate glycosyltransferase OS=Nocardioides sp. (strain ATCC BAA-499 / JS614) OX=196162 GN=mshA PE=3 SV=1
Q2JFV0	8.79e-12	183	374	226	424	D-inositol 3-phosphate glycosyltransferase OS=Frankia casuarinae (strain DSM 45818 / CECT 9043 / CcI3) OX=106370 GN=mshA PE=3 SV=1
D5UJ42	8.98e-12	181	374	240	436	D-inositol 3-phosphate glycosyltransferase OS=Cellulomonas flavigena (strain ATCC 482 / DSM 20109 / BCRC 11376 / JCM 18109 / NBRC 3775 / NCIMB 8073 / NRS 134) OX=446466 GN=mshA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003019_01048.