CAZyme Information: MGYG000003035_00384

Basic Information

• Species: CAG-485 sp900542185
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900542185
• CAZyme ID: MGYG000003035_00384
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
488	MGYG000003035_4|CGC3	54195.66	4.5902

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003035	3548444	MAG	Netherlands	Europe

• Gene Location: Start: 82052; End: 83518 Strand: -

Full Sequence      

MNRHNNLMNRFLIWTGLVGALAGFSSCTDDGDKISIEGPVSISVTKDGADVNALEFGTYA
SSAVLTLETNAPWEVKVSEGSEWLTLSNRSGDPTVPSDSTAKNEPRYIKLSVEPLGDNAT
RTCTVTFKAMDQVKTISVTQKKPEASDESGWESAQSANMNMGVGVNLFNTLDAVGDWFDP
DDVSAWETCWGMPQAKQEWFDAVAASGFKAVRIPVSWGGHLNENNMVKEPWMNRVEEVVN
YALKAGLYCILNTHHEGGWLIADKANIEPIRAKFATLWTQIATRFNKYDHHLIFEGYNEL
LDQNGSWTEPAEGGYDAVNILAQTFVDAVRATGGNNLHRNLIVNTYSGGGSSTRLANLVI
PQDKIPGHIMVEVHNYTPAAFSNLDSSISDDTPEEELPLWTKEFEKMLKSELDLLIEYSN
KQGIPVVIGECGAYERIKEEERAKYSEFISTYARGNANISIFYWGHLIDRNSFKELYPKF
IDGFLKGQ

Enzyme Prediction     

EC	3.2.1.73	3.2.1.78	3.2.1.4	3.2.1.8	3.2.1.151

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	187	464	1.1e-86	0.9782608695652174

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	3.90e-55	171	464	1	266	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.59e-16	151	434	30	324	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
cd14948	BACON	2.23e-11	41	141	1	83	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam13004	BACON	5.65e-04	73	141	1	61	Putative binding domain, N-terminal. The BACON (Bacteroidetes-Associated Carbohydrate-binding Often N-terminal) domain is an all-beta domain found in diverse architectures, principally in combination with carbohydrate-active enzymes and proteases. These architectures suggest a carbohydrate-binding function which is also supported by the nature of BACON's few conserved amino-acids. The phyletic distribution of BACON and other data tentatively suggest that it may frequently function to bind mucin. Further work with the characterized structure of a member of glycoside hydrolase family 5 enzyme, Structure 3ZMR, has found no evidence for carbohydrate-binding for this domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRX63738.1	3.96e-94	23	482	20	473
QPB75690.1	7.44e-82	17	486	3	499
AEV46038.1	2.34e-76	166	456	2	295
AEX97596.1	6.12e-76	153	488	34	383
AHF24720.1	2.74e-73	144	472	34	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5D9N_A	3.11e-70	152	434	11	284	Crystalstructure of PbGH5A, a glycoside hydrolase family 5 member from Prevotella bryantii B14, in complex with the xyloglucan heptasaccharide XXXG [Prevotella bryantii],5D9N_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 member from Prevotella bryantii B14, in complex with the xyloglucan heptasaccharide XXXG [Prevotella bryantii],5D9P_A Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, in complex with an inhibitory N-bromoacetylglycosylamine derivative of XXXG [Prevotella bryantii],5D9P_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, in complex with an inhibitory N-bromoacetylglycosylamine derivative of XXXG [Prevotella bryantii]
5D9M_A	1.71e-69	152	383	11	247	Crystalstructure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, E280A mutant in complex with the xyloglucan tetradecasaccharide XXXGXXXG [Prevotella bryantii],5D9M_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, E280A mutant in complex with the xyloglucan tetradecasaccharide XXXGXXXG [Prevotella bryantii],5D9O_A Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, E280A mutant in complex with cellotetraose [Prevotella bryantii],5D9O_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, E280A mutant in complex with cellotetraose [Prevotella bryantii]
3VDH_A	1.02e-67	152	434	11	284	Crystalstructure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14 [Prevotella bryantii],3VDH_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14 [Prevotella bryantii]
6D2W_A	2.79e-66	152	434	434	707	Crystalstructure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14],6D2W_B Crystal structure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14]
6WQP_A	5.93e-62	163	486	25	354	GH5-4broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQP_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQV_A GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_C GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_D GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54937	4.57e-60	121	454	7	333	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1
P23660	2.32e-54	153	464	26	328	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1
P28621	2.23e-48	153	453	41	328	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
P10477	1.68e-47	163	487	66	384	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
P28623	4.86e-47	154	487	43	371	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000066	0.001568	0.998409	0.000002	0.000003	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003035_00384.