CAZyme Information: MGYG000003035_01272

Basic Information

• Species: CAG-485 sp900542185
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900542185
• CAZyme ID: MGYG000003035_01272
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
767	MGYG000003035_17|CGC3	84139.82	6.1479

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003035	3548444	MAG	Netherlands	Europe

• Gene Location: Start: 52072; End: 54375 Strand: +

Full Sequence      

MNHKIIISLLLASGCAFAFARPPLYKDAGQPVEKRVEDLMSRMTLEEKIAQMSQFVGPNH
IRENQQRFKGKSVAKNDDAYGFYPTLSVNDLYRMTQEGKIGSFLHVVTAEEANELQRLAA
KSRLGIPLIIGIDAIHGNALVSGTTVYPTPIGQASTFNEELVERLSRESAREVRAGGAHW
TFTPNVDVARDARWGRVGETFGEDPWLVSRMGVATVRGYQGARIGNNSVLACAKHLIAGS
EPSNGTNAAPMDVSERTLREVFLPPYKAAVQEAGVATLMAAHNELNGIPCHADRWMMTDI
MRDEYGFDGFIVSDWMDVSRIHDLHHAALDLDDAYRQAVEAGLDMNMHGPGFAESILKQV
EAGTVSKDVIDRACRAILTAKFNLGLFENPYVDLSDSKKTLFNANHRKTALKAAEQSIVL
LKNANNLLPLDLSKINRIFVTGPNADNQTILGDWTLPQPDENVTTVLEGLRRVAGKGKVT
YYDYGDDVRQNSPVKVKEAAAMAREADVAIVVVGENPLRYQKGKTCGENTDRMNLELLGT
QEQLVIDIAATGVPTIVVLTGGRPLAIPEIDKKVSAVLQAWEPGSEGGLAVAEIIAGQVN
PSAKLPVSMPYSSGQIQMIYNHKPSQYFHKYKDGPSKPLYPFGYGLSYTDFTISEPVLDK
TVAGTTDTVKVTATVTNIGLREGSEVVQLYIRDDISTVTRPVKELKDFVRVSLKPGESRT
VEFDITPEKLAFFDRNMKYSVEPGDFTVMVGSSSLDKDLKTTCLTIK

Enzyme Prediction     

No EC number prediction in MGYG000003035_01272.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	119	347	2.4e-76	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	1	754	1	754	beta-glucosidase BglX.
COG1472	BglX	7.23e-103	43	456	1	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	5.85e-91	119	751	74	769	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	1.18e-74	44	380	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	4.70e-63	418	648	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT43879.1	0.0	1	766	2	767
QUT22695.1	0.0	1	760	5	765
QUT73851.1	6.58e-318	5	760	6	760
AFL77929.1	4.52e-302	6	767	8	766
QIU93423.1	1.30e-297	7	767	10	770

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5TF0_A	3.08e-151	30	767	7	751	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5XXL_A	1.35e-148	30	767	8	752	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	7.50e-148	30	767	8	752	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5Z9S_A	1.77e-145	25	766	17	787	Functionaland Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum],5Z9S_B Functional and Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum]
6R5I_A	1.70e-141	33	764	4	732	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	2.64e-161	82	767	14	723	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q56078	2.63e-146	36	754	38	754	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	2.29e-140	5	754	9	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	7.43e-127	4	756	3	746	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
Q23892	1.49e-115	36	755	80	816	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000666	0.706208	0.292459	0.000255	0.000212	0.000185

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003035_01272.