CAZyme Information: MGYG000003035_01531

Basic Information

• Species: CAG-485 sp900542185
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900542185
• CAZyme ID: MGYG000003035_01531
• CAZy Family: GH128
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
487	MGYG000003035_23|CGC1	53810.94	4.5466

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003035	3548444	MAG	Netherlands	Europe

• Gene Location: Start: 9696; End: 11159 Strand: +

Full Sequence      

MMRDKLVIGMAVVLTCMASAPAWGKSAKRGVGENQFSLAVELDAIKPGVNWYYNWANTPS
SGVDGQVEAYEGIDFVPMCWNANYNADKIREYVKAHPECKYLLGFNEPNFTQQANMTPEV
AAEKWHAVQALAEELNLKLVAPALNYSPNAPYQDPMKWMDEFVALVGPDAFDYTAIHVYG
GYGVLTDLATKFHDKYGKDVWVTEFCYWPEAGNQNSSVSQATQINFMTQALEWLETTPWI
HKYAWFKAKGAYNSNKGPNYGLIIPQTGYDERKLSPQGMVYCYMSDFDREVWNAVGTEFP
AVDYVASSAIELYPGNDAGCAKPIEISRFNSGSTVDWQFDVPDAGKYDLKLIVAGMGEPT
RFDPQLKVQLVNGDEVTDLTDVVSMTLPNSDEKYEARAINVTLPAGHVILRLADAAPYQP
SGIRISRVGLYAEGTGAVEGVAAEILTNVNVYNMQGVMLKHDVDPASAIEGLTPGLYIIG
NRKVLVK

Enzyme Prediction     

No EC number prediction in MGYG000003035_01531.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	44	263	7.7e-56	0.9196428571428571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam11790	Glyco_hydro_cc	3.93e-55	42	281	11	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU93826.1	5.68e-66	25	412	51	427
ARU26557.1	4.72e-55	26	412	115	483
ABD80707.1	5.72e-49	25	354	88	408
AHG40813.1	1.64e-48	2	281	10	286
QVI73481.1	6.36e-47	8	281	15	285

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UAV_A	3.11e-42	25	281	2	253	Crystalstructure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Pseudomonas viridiflava (PvGH128_II) [Pseudomonas viridiflava]
6UAW_A	5.72e-42	25	281	24	275	Crystalstructure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Pseudomonas viridiflava (PvGH128_II) in complex with laminaritriose [Pseudomonas viridiflava]
6UAX_A	2.85e-35	28	249	95	319	Crystalstructure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56],6UAX_B Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56]
6UAQ_A	2.64e-22	28	246	25	235	Crystalstructure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei],6UAR_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose [Amycolatopsis mediterranei]
6UFL_A	6.69e-22	28	246	25	235	Crystalstructure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) in the complex with laminarihexaose [Amycolatopsis mediterranei],6UFZ_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000302	0.998941	0.000208	0.000205	0.000159	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003035_01531.