CAZyme Information: MGYG000003039_00195

Basic Information

• Species: Collinsella sp900552385
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900552385
• CAZyme ID: MGYG000003039_00195
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
721	MGYG000003039_1|CGC2	79271.94	4.869

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003039	1762889	MAG	Netherlands	Europe

• Gene Location: Start: 218562; End: 220727 Strand: +

Full Sequence      

MSESIYTLRVSRAAAGAYPTISDALAATDQLYPDAEQAVTIHIDPGEYRERVEIHRPHVT
LAGETADSVRIVGSLGAKMPSEDGSGVDGTLGTFRTYTVLVDADDVRLENLTIVNDAGDG
REVGQAIALYADGDRLVVDACCITGRQDTLFLGPLPPREVKPGGFMGPKQFAPRRVGRQY
FRRCRIEGDVDFIFGGARAYFEGCEIRSLNRDMDVNGYVTAASTPEGEPYGFVFHGCSFT
APDDVAPDSVYLGRPWREWAQTVLIDCWLGQHIKREGWWDWNKPAAHERARYVGTSLHGP
AGDAAGWAPWTRELDATAAARYAREQVLAGADGWDPEGGDGDAVETASLSDSGRTVHIDI
YYEDEPALRDRLKREGRSAAFKGATPGDFEAWQIATRDRLFDLLGLSIMDRAPIEVRELD
RVQIAGGIVRTHAMLQVERDVWMPFYLLEPQAPKLDAHGCKRCYICPHGHQGAGAASVAG
VTGVPAVDDAVRKFNYDYGLRLARMGYVTVCPDARGWGSRRDWKGQGDDENSYLRGTCLN
QARMAEPLGLTVAGLNAWDNMRLIDYLETRGDIAMDDLGCFGFSGGGYMTLYLAALDPRV
RKAFVSGYLYGVDDSLLHLNGNCSCNYTPGLWRLLDMGDIASLIAPHPLLVQSCEEDHLN
GSRGLKNVDEQLEIVRDAYKLLGRRDGLRHEVCPGEHHLGVAHLAEDIEWLDSHVAECAR
A

Enzyme Prediction     

No EC number prediction in MGYG000003039_00195.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	10	329	4.4e-81	0.9826388888888888
CE19	463	698	4.7e-26	0.5783132530120482

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	1.19e-64	6	330	81	404	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	1.97e-47	16	282	10	246	Pectinesterase.
PLN02708	PLN02708	3.63e-42	10	336	245	550	Probable pectinesterase/pectinesterase inhibitor
PLN02773	PLN02773	3.09e-41	8	322	7	290	pectinesterase
PRK10531	PRK10531	1.24e-40	10	279	84	383	putative acyl-CoA thioester hydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA34433.1	0.0	1	719	1	719
ATP54718.1	0.0	1	721	1	721
QUC03567.1	0.0	8	712	7	706
QIX89293.1	3.19e-97	8	336	17	348
QRP39805.1	1.29e-96	8	336	18	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	5.47e-26	10	300	7	267	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	4.91e-24	16	278	17	245	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	8.99e-24	16	278	17	245	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
3UW0_A	8.67e-23	33	289	55	311	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	5.05e-22	18	289	18	287	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GXA1	5.11e-31	10	337	260	559	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q9LVQ0	3.93e-30	8	314	7	282	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8L7Q7	5.13e-28	18	314	301	578	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2
Q9LXD9	2.73e-27	18	314	251	527	Probable pectinesterase/pectinesterase inhibitor 51 OS=Arabidopsis thaliana OX=3702 GN=PME51 PE=2 SV=1
Q43062	3.84e-27	10	330	211	505	Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica OX=3760 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000012	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003039_00195.