CAZyme Information: MGYG000003041_01834

Basic Information

• Species: Collinsella sp900544235
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900544235
• CAZyme ID: MGYG000003041_01834
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348		39643.52	4.7295

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003041	2078819	MAG	Netherlands	Europe

• Gene Location: Start: 23; End: 1069 Strand: +

Full Sequence      

MTITHFDCPIHLIKEYGGWRNRKLIDFYKNLATTIFTRYKGLVKYWLTFNEINMILHLPF
MGAGLVFEEGENKEAVEYLAAHNELVASAWATKIAHEIDPEIKIGCMLAAGSYYPYSCRP
GDVRQAQLDNQDNYFFVDVQSRGYYPAYAVKKLERLGIDVGMTDEDREILAANTVDFISF
SYYSTRCSAGADNPDVERTQGNAFAGAKNPYLQESQWGWAIDPLGFRITLNDLYDRYQKP
LFVVENGLGAKDVVEEDGSINDDYRIDFLRQHIQTMRDAVTEDGVDLLGYTTWGPIDLVS
AGTGEMSKRYGFIYVDRDDAGNGTLKRSKKKSFDWYKHVIETNGEDLS

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	1	344	3.4e-95	0.7272727272727273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09852	PRK09852	0.0	1	348	130	474	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09593	arb	0.0	1	348	132	478	6-phospho-beta-glucosidase; Reviewed
PRK09589	celA	7.01e-165	1	347	126	476	6-phospho-beta-glucosidase; Reviewed
COG2723	BglB	7.86e-156	1	348	118	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK15014	PRK15014	6.53e-141	1	347	128	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZH68819.1	9.73e-263	1	348	129	476
ATP54514.1	1.43e-241	1	348	129	476
QWT17213.1	3.26e-212	1	347	129	474
AEB07701.1	5.55e-199	1	348	129	475
QKH60250.1	3.07e-194	1	348	129	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	2.09e-155	1	347	125	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	1.07e-132	1	347	130	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	1.52e-127	1	347	129	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	4.32e-127	1	347	129	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	4.53e-124	1	347	129	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24240	3.31e-160	1	347	130	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P40740	2.31e-149	1	347	125	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q48409	4.81e-135	1	347	122	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
Q46829	5.84e-132	1	347	130	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P42973	1.17e-131	1	347	126	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000006	0.000038	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003041_01834.