CAZyme Information: MGYG000003042_01682

Basic Information

• Species: Gemmiger sp900545545
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger; Gemmiger sp900545545
• CAZyme ID: MGYG000003042_01682
• CAZy Family: GH3
• CAZyme Description: Xylan 1,4-beta-xylosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
867	MGYG000003042_10|CGC1	95681.11	4.8041

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003042	2618954	MAG	Netherlands	Europe

• Gene Location: Start: 15069; End: 17672 Strand: +

Full Sequence      

MFPYQDAKLPIEKRIDDLLGRMTLREKILQTDQYFSGDFTTQDENGQVTAMDLDRLDKLL
QGYSAGSVQLRGMDAAQANTVQRYAIEKTRLGIPFLFSEEALHGLMTNRATSFPQQIGLA
ATFHPELGREMGHAIATETRAMGIHETYSPVMDLIRDPRYGRGEESYGEDTHLCGEFARE
VVRGMQGDDLTAPDAIAAEPKHYVGYGNPVGGLNCAPCTMGRHDVFSDCLPVFEAAFRDG
GAVDAMCSYNSIDSIPVSMDHELLTDVLRGQYGMRGFVRTDLTAVSRLYDWHFIAPTPEE
AIRLGVEAGVDLQLYDFPHDVWQDSLQHLVESGKMDVSVVDTACRRVLRVKFMLGLFEHP
YTDEHRAETVLRRPEHLDLARRIARESVVLLKNDGILPLRKDLGCVAVIGPGADTPALGD
YSEARGRVGAVTVLDGIKAAVAPGTKVLHARGCNFLGQALHPFDPGMLLDEDGNPGLTGR
YYNGPKPEGTPVQTRSDRTVNFNWIFALPHPELDANCFSVAWTGYVCMPKTMDGCIGLST
QDSMKLYVDDELLIDGWGPDKSADQALDFHFEAGRRYKVRIEFVNDGRGARVIFGYSAGR
EDFDSAVAAAKQADVAILCMGDNEETSGENFDRISLDLPGRQLELVKAVYATGTPVVLLL
QSGRPVSANWENEHLPAILEAWFPGEQGGNGIADVLFGDAAPTGRLPITFPRSVGQVPCH
YSRRPGGGKRYVEMDWMPLYPFGYGLSYTSFAFRDLALDRTEMDPGDTVQVSFTVENTGA
RPGVAVPQLYVRDYYSSVVKPERQLAAFTRVELAPGESRRVTLPVGPRALRTLGPDYVWR
VEPGDFEIQLGDNAENILLRTDLTVRG

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	87	314	1.7e-59	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	3.24e-177	3	851	23	751	beta-glucosidase BglX.
COG1472	BglX	3.89e-79	22	454	1	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	3.63e-77	2	852	40	770	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	1.05e-59	388	748	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	1.56e-58	23	350	1	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ98992.1	3.48e-317	2	865	9	869
QAY68112.1	5.49e-295	4	865	9	876
BBI31696.1	2.06e-287	4	865	11	879
AXP81467.1	4.43e-238	3	865	25	879
APA00260.1	2.13e-234	3	858	30	878

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	2.03e-132	5	857	4	744	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	1.11e-131	5	857	4	744	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5Z87_A	3.26e-130	4	857	36	777	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5YOT_A	2.33e-127	4	857	7	748	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	1.77e-126	4	857	7	748	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	1.24e-121	15	857	38	757	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH9	3.38e-117	4	854	29	744	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
P33363	2.29e-116	15	857	38	757	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	7.85e-110	39	866	15	723	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
A7LXU3	5.13e-92	11	858	35	769	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003042_01682.