CAZyme Information: MGYG000003042_01848

Basic Information

• Species: Gemmiger sp900545545
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger; Gemmiger sp900545545
• CAZyme ID: MGYG000003042_01848
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
453	MGYG000003042_12|CGC2	50182.49	4.822

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003042	2618954	MAG	Netherlands	Europe

• Gene Location: Start: 61104; End: 62465 Strand: -

Full Sequence      

MADWRQALHLEPPQGWLNDPNGLCFFHGLYHVFFQYSPGSADGTSAKGWGHWQSPDLLHW
TFTGEPLLPDTPWERNGAYSGCAVPCGEVLRLYYTGNVKHPGPYDYIHTGREANTLLAET
PDGIHVGPKQRLMASTDYPADCSLHVRDPKVWREADRWYMLLGARSLQDAGRVLLYRSAD
GLAWELARVLEPAPAFGYMWECPDHFILDGRRWLSVSPQGLPHGETENQNQYQSGWFALN
GDLETGTLSGFTEWDKGFDFYAPQTLQAPDGRLLLIGWMGMPDADYRNPTAALGWQHCLT
LPREIEAGPDGLCQRPLRELDALADGQPLALTAGQTLALPLPFRLRMTADRDFTLTLAGG
LRLERDTGAGRLTLRFDDEALGGGRTLRRAVCGEGPLTVDLVADRASLEFYCGGGTTVFS
TRFYPADSTIPVAVQGADATVQPLRPMTFAIEE

Enzyme Prediction     

No EC number prediction in MGYG000003042_01848.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	9	316	6.2e-85	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	6.39e-150	15	305	1	285	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	5.31e-129	4	426	13	445	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	3.31e-117	3	427	27	461	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
pfam00251	Glyco_hydro_32N	2.15e-99	9	316	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	8.32e-96	9	415	1	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM70237.1	1.33e-154	3	448	4	436
CCO04388.1	1.81e-152	2	441	16	453
CCG05878.1	1.00e-138	5	444	29	463
CBL24955.1	1.04e-132	2	445	28	474
QNM06260.1	1.74e-131	4	440	28	472

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	3.74e-67	2	425	23	459	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	5.22e-60	4	452	48	478	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	7.61e-59	4	452	48	478	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
3PIG_A	5.08e-53	4	427	39	488	beta-fructofuranosidasefrom Bifidobacterium longum [Bifidobacterium longum],3PIG_B beta-fructofuranosidase from Bifidobacterium longum [Bifidobacterium longum],3PIJ_A beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum],3PIJ_B beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum]
6NU7_A	4.90e-52	2	433	30	471	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27217	1.93e-91	9	425	31	439	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3
P16553	1.84e-84	4	428	23	453	Raffinose invertase OS=Escherichia coli OX=562 GN=rafD PE=3 SV=1
P37075	8.51e-83	9	428	31	442	Sucrose-6-phosphate hydrolase OS=Salmonella typhimurium OX=90371 GN=scrB PE=3 SV=1
P07819	1.46e-80	5	425	29	454	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
P40714	1.17e-78	8	425	28	450	Sucrose-6-phosphate hydrolase OS=Escherichia coli OX=562 GN=cscA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003042_01848.