CAZyme Information: MGYG000003056_02102

Basic Information

• Species: Fusobacterium_A sp900543175
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium_A; Fusobacterium_A sp900543175
• CAZyme ID: MGYG000003056_02102
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
342		40194.35	9.3764

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003056	2294801	MAG	United States	North America

• Gene Location: Start: 433; End: 1461 Strand: -

Full Sequence      

MKILVVRFKQIGDAILSSVICNTLKRTFPDAEVDYVVYEHISPLFENHKYIDNVIAITKE
EQKNPFKYLAKVWKVTRKKYDIVIDIMSTPKSEVFTLFSLGSRYRIGRRKPKRGYTYNYK
IDEPRDAKDKVDKFLKMLKPLEQEYKVIYDNNYVITLTSEEKFQMRKRMLDAGVNFSRPV
YICAANSRRESKIYNTEKMKKIVERVRDELKGQVIFFYSPDEKDFIMKFYEKFEDKKDLF
VNINTKSIRELAMVIANCDFFFGNEGGPRHLAQSLDIPSFAIFSPSASKKEWLSNANERH
QGVEPGDVGNCEGLDYNGQYNLIDPDYVFDKIEEMSKKFIVK

Enzyme Prediction     

No EC number prediction in MGYG000003056_02102.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	71	304	1.6e-33	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	3.75e-53	1	334	2	328	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	1.55e-51	2	334	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK10422	PRK10422	2.81e-12	2	296	7	303	lipopolysaccharide core biosynthesis protein; Provisional
pfam01075	Glyco_transf_9	4.94e-11	70	286	2	212	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH40966.1	4.90e-171	1	340	1	341
AVQ30453.1	4.90e-171	1	340	1	341
BBA49832.1	1.31e-169	1	340	1	340
SQJ14939.1	3.16e-169	1	340	1	340
AVQ27547.1	3.16e-169	1	340	1	340

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	1.34e-06	2	286	10	290	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9R9D5	7.15e-06	12	283	5	276	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003056_02102.