CAZyme Information: MGYG000003063_00391

Basic Information

• Species: Eisenbergiella sp900544445
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900544445
• CAZyme ID: MGYG000003063_00391
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402	MGYG000003063_5|CGC2	45840.64	5.05

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003063	3890464	MAG	United States	North America

• Gene Location: Start: 53916; End: 55124 Strand: +

Full Sequence      

MQEIRIGFIGLGSRGYGLLRDVVLKQKEQVMAVCDVYEDRTQKGAELVAEAGQARPAEYT
DYRDVIRDENVNTIIIATAWESHVRIALEAMYAGKAVAMEVGGAYELKDCWDLVEAYEKT
GTPFMFLENCCFGRREMMALNMVRKGLFGEVVHCAGGYQHDLRDEISFGRENRHYRLRNY
LNRNCENYPTHDLGPIAKVLNINRGNRMLTLASTASKAAGLRDYIRENKSEDEFLKNQTF
AQGDVVTTVIRCAHGETIVLTLDTTLPRYYSRNFTVRGTKGMYEEVTDSVFLDRPEDKAH
DFDWRKTCSGNAAQYEEEYDHPVWKKYIQEGVQGGHDGMDWLEFQTFFSCLRENSPMPVD
VYDAASWMAVTALSEMSIARGGAVVDVPDFTNGRWHERLPQE

Enzyme Prediction     

No EC number prediction in MGYG000003063_00391.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	1	397	5.4e-151	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	2.87e-20	1	384	1	338	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	8.17e-10	4	125	1	117	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO31207.1	7.01e-186	1	398	1	398
QIB57148.1	8.29e-182	1	395	1	389
QMW80076.1	8.29e-182	1	395	1	389
QBE96673.1	8.29e-182	1	395	1	389
QTH41319.1	6.41e-174	2	395	6	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	1.22e-108	2	395	19	431	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	2.69e-76	1	400	40	443	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
3EC7_A	3.41e-10	4	121	24	138	CrystalStructure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_B Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_C Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_D Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_E Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_F Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_G Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_H Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3NTO_A	1.79e-06	2	155	1	154	Crystalstructure of K97V mutant myo-inositol dehydrogenase from Bacillus subtilis [Bacillus subtilis],3NTQ_A Crystal structure of K97V mutant myo-inositol dehydrogenase from Bacillus subtilis with bound cofactor NAD [Bacillus subtilis],3NTQ_B Crystal structure of K97V mutant myo-inositol dehydrogenase from Bacillus subtilis with bound cofactor NAD [Bacillus subtilis],3NTR_A Crystal structure of K97V mutant of myo-inositol dehydrogenase from Bacillus subtilis with bound cofactor NAD and inositol [Bacillus subtilis],3NTR_B Crystal structure of K97V mutant of myo-inositol dehydrogenase from Bacillus subtilis with bound cofactor NAD and inositol [Bacillus subtilis]
3E18_A	5.83e-06	2	153	7	148	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4Q8F7	6.66e-108	2	395	19	431	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
B2FLK4	2.11e-100	2	400	32	446	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A4Q8G1	1.14e-97	4	400	53	464	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A6LB54	1.52e-97	3	401	49	463	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
Q01S58	1.16e-86	4	400	43	437	Glycosyl hydrolase family 109 protein OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=Acid_6590 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003063_00391.