CAZyme Information: MGYG000003063_01300

Basic Information

• Species: Eisenbergiella sp900544445
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900544445
• CAZyme ID: MGYG000003063_01300
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359	MGYG000003063_22|CGC1	40877.47	4.603

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003063	3890464	MAG	United States	North America

• Gene Location: Start: 3322; End: 4401 Strand: +

Full Sequence      

MSTENSALYYAKAAVETMMRKFQAQDLPPKGHFHYHQGVFLSGVYQTYLLCGDRRYFDYM
KGWVDSCVDEKGEIHECDLGALDDIQPGILLYPLLDETGDERYKKALDTLLAAIKDFPRN
EIGGFWHKVDCPEQMWLDGLYMGGPIAAEYGSRFHQPEFLDLVVKEALLMREKTRDEKTG
LWYHAWDYAKKQEWADPETGLSSEFWGRSIGWVPVAVLDDLDFLPEDHPGYEKLCALVKE
LLEAVCRYQSEDGRWYQVVNKGGMEGNWLENSCSCLFVAAICKAVKKGILPEEYLEKARR
GYEGVIRSLEWDGDDLLVGNVCIGTGVGDYRHYCERPVSINDLHGVGAFLLMCAQVEGL

Enzyme Prediction     

No EC number prediction in MGYG000003063_01300.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	28	357	1.3e-104	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	6.55e-110	10	351	11	348	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	4.67e-104	10	351	1	334	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ92567.1	3.70e-170	6	359	4	358
ATO42094.1	7.72e-170	5	357	4	357
AFU70692.1	7.72e-170	5	357	4	357
QYN59722.1	7.04e-164	1	357	2	359
BCJ93957.1	4.11e-142	4	357	6	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NC5_A	7.13e-111	6	359	12	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.93e-110	6	359	2	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4WU0_A	3.74e-71	10	359	4	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3PMM_A	5.15e-24	38	352	71	374	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	9.55e-24	16	332	46	356	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	3.90e-110	6	359	12	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.65e-27	142	359	1	229	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.65e-27	142	359	1	229	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
P9WF04	3.08e-08	136	356	201	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003063_01300.