CAZyme Information: MGYG000003063_01487

Basic Information

• Species: Eisenbergiella sp900544445
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900544445
• CAZyme ID: MGYG000003063_01487
• CAZy Family: GH27
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
643	MGYG000003063_27|CGC1	72578.61	4.9362

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003063	3890464	MAG	United States	North America

• Gene Location: Start: 12747; End: 14678 Strand: -

Full Sequence      

MAGWIYTENGFWELEAEGKRILKAYARAESTDGRCVDTRTARLEERTQEDGMQTLRFFGE
EGLILTERLSVTPGGMAWADCTLQEADGTEAASRLLTPLVFSAPDAKEGIPAPAIWKNLW
IRMLCVPYDNTMWLRYEALPLKAGRRSYDLSVIYSEDSREGILVGALDFDCWKNGIVCSA
TDANTLEARCGMADEGTHDTQPHGILRGAQVSSSRFGVLYGADYRKLLEAYGDFLSAERP
PLKWEQGVPFGFNSWAGLAFRLNEERYENSGEFVRTELMPGGYENQGTTYVNLDAGWNVM
SPERLAAQADRLHQAGQKAGIYDAPFAFFGRDPEEEIPGVPGHFYKEILLRDEKGRFLPR
VDGAIPYDVTHPLWERMTRYKFERFVRWNYDYVKVDFMTHGGMEGCHSDRTISTGRQAIN
RAYAFLDDLLDEKKIGRPFFISLSIAPIFPYGYGHARRVSCDAFGTAQDVEYELNSHTYG
WWLNGRLYQYNDPDHIVLLKSFGMEKDNTEGEARARYTTAVIGGTVMMLSDDYERPEARE
RAKKLACNPAVNRIAASQIAFLPVESAEGSASRAYTAVVNGKTCVALFHWEDRKETVILD
AARAGLKRDTAYTDLWSGRTFRSENGLLHWEIDGCDALLLQEC

Enzyme Prediction     

No EC number prediction in MGYG000003063_01487.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH27	380	619	2.2e-17	0.9388646288209607

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14792	GH27	4.10e-16	249	558	2	270	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd14791	GH36	1.56e-09	249	544	3	292	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
PLN02692	PLN02692	6.12e-06	249	443	57	208	alpha-galactosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCK01163.1	7.11e-231	5	641	16	683
ANE45666.1	2.14e-129	7	612	29	645
AYB43258.1	2.10e-128	102	628	138	670
ACX66631.1	4.58e-127	102	641	137	681
AYQ71136.1	5.61e-127	121	618	150	654

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003063_01487.