CAZyme Information: MGYG000003064_00173

Basic Information

• Species: Bacteroides graminisolvens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides graminisolvens
• CAZyme ID: MGYG000003064_00173
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
824	MGYG000003064_1|CGC6	93554.57	6.827

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003064	3410784	MAG	United States	North America

• Gene Location: Start: 252298; End: 254772 Strand: -

Full Sequence      

MKRLVVFSFLIVSICSLTARAAEKFISFNTVNDGFLLCPSNGTITYDDNDWEGVKIAIRN
LQNDLKAVTGSDKANIVIGTVGKSKYLKSYGKINKALKGKWEQYIITTDGDKLIIAGSDK
RGTIYGIYELSRQIGVSPWYWMADAPIAKHDRIYVSRGEYTDGEPAVKYRGIFINDEWPS
FGTWCNTHFGGINSKAYSKIFELLLRLKANYLWPAMWDSRFNEDDPLSPKVADEMGIVMG
TSHHEPMMRAHKEYVTRKDSVGPWDYAMNPNRLDKFFTEGIERNKSYENIITIGMRGDGD
VAMGAGNDADNMKTLKKVIASQRNIINKVYGKPASSVPQLWAIFTEVQRYYDAGFTVPDD
VTLLLCDNNWGYIRRIGRDFERKRKGGLGLYYHIDMNGGPWNDRWVNTTTVPKLRQQLNL
AYKTGLDRIWIINVGDLKPKEMPIDFIMKYAWNPDAIQPGDEKAYQEEFAESIFGKEYAS
EIADIISKYSKYNLWRKAEVQYPGIFNMEEMMRTNNLWQSLVLRCDALKGKIPAEAQDAF
YQLVYYPAVASAGVAMIYNCATLGDSATIELLMQKDKRLADYYNNELAGGKWKGMMLDNH
IGYTQWSIPDKNRNPMTLGFKVEHSLYPKEDTKEYSIPAYQYTNKTDGQDAKWIFLPDLG
RGDGCMGIDNVLAKSDETGKGATLEYEVDLSTGQVAIGILPTQDIYPARGLRIGVQLDDQ
PMQILDARRGLVDTFSEYTKQNLAVSKVLKPLPSRSQLSLSGFVNGSQLPRRDEVFDNIR
WLDVSFSTHPGKHTLKIIMIDPEIVVEQIVVNPDNNSYSYFGNW

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	42	809	8.4e-222	0.9813486370157819

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	163	500	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	1.81e-29	636	822	10	169	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	0.001	54	130	33	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EEC55419.1	0.0	43	822	54	987
QRQ50360.1	0.0	43	822	29	962
QUT25621.1	1.24e-288	24	822	33	1003
QRQ59056.1	1.09e-287	24	822	4	974
ALJ47135.1	2.48e-287	24	822	29	999

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	3.26e-171	1	820	12	843	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	1.04e-161	23	812	4	820	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	2.98e-160	25	616	5	630	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
7PXQ_A	4.77e-159	23	812	3	819	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
6NPS_A	2.48e-110	30	616	6	654	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000202	0.999179	0.000179	0.000145	0.000138	0.000128

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003064_00173.