CAZyme Information: MGYG000003064_00310

Basic Information

• Species: Bacteroides graminisolvens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides graminisolvens
• CAZyme ID: MGYG000003064_00310
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
278	MGYG000003064_1|CGC9	32025.26	4.652

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003064	3410784	MAG	United States	North America

• Gene Location: Start: 393821; End: 394657 Strand: +

Full Sequence      

MIVIMAKANKVLFITQEITPYVADTEMANIGRYLPQAIQEKGREIRTFMPKWGNINERRN
QLHEVIRLSGMNLIIDDTDHPLIIKVASIQAARMQVYFIDNDDYFQNRLQTCDENGLEYE
DNDSRAIFYARGVLETVKKLRWAPDVIHCHGWLTALAPLYIKKAYADEPSFRDTKVVFSV
YGEDFKSTFKEDFPSQLIIKGVSADDIKSLSTPVDYTSLMKLAIDYSDGVVQNSESVNEE
VMNYARQSGKLVLDYQTPEAFHDACDEFYDKVWESENK

Enzyme Prediction     

No EC number prediction in MGYG000003064_00310.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	10	246	1.6e-47	0.4766949152542373

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08323	Glyco_transf_5	3.71e-55	11	242	1	225	Starch synthase catalytic domain.
PRK14098	PRK14098	2.68e-47	5	236	1	241	starch synthase.
cd03791	GT5_Glycogen_synthase_DULL1-like	2.23e-34	10	259	1	227	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	8.24e-27	10	180	2	153	glycogen synthase GlgA.
COG0297	GlgA	1.16e-23	10	180	2	164	Glycogen synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CUA17568.1	5.50e-171	2	278	51	327
QUU01782.1	5.50e-171	2	278	51	327
QCQ44992.1	1.90e-170	5	278	1	274
QKH84863.1	1.90e-170	5	278	1	274
ANQ59644.1	1.90e-170	5	278	1	274

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RZU_A	4.35e-06	11	199	3	181	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4SC83	8.57e-42	5	256	1	253	Glycogen synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) OX=324925 GN=glgA PE=3 SV=1
B3EGV0	2.31e-41	5	233	1	238	Glycogen synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330) OX=290315 GN=glgA PE=3 SV=1
A1BIY8	3.28e-38	5	220	1	224	Glycogen synthase OS=Chlorobium phaeobacteroides (strain DSM 266) OX=290317 GN=glgA PE=3 SV=1
B4S584	1.25e-37	10	236	7	240	Glycogen synthase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) OX=290512 GN=glgA PE=3 SV=1
Q3APL6	4.53e-37	9	220	6	224	Glycogen synthase OS=Chlorobium chlorochromatii (strain CaD3) OX=340177 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003064_00310.