CAZyme Information: MGYG000003064_00992

Basic Information

• Species: Bacteroides graminisolvens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides graminisolvens
• CAZyme ID: MGYG000003064_00992
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
534		61578.72	9.9057

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003064	3410784	MAG	United States	North America

• Gene Location: Start: 185071; End: 186675 Strand: -

Full Sequence      

MRYRYLYYILLLIPAFLFRDYTPTNELKYISIVDEALKNGTWFTFYNHGAVYADKPPLFF
WLIMLIKLITGTYNMWLIGLFSLLPTIGIMAVMDRWVRKEGIASNPLVSNVLLLTTGMFL
GSALVVRMDMLMTFFIVVSLYIFWTIYKNDEHVRIGRSVLPVFIFLALFTKGPIGLLIPV
VSIISFLVLKKQIRTIGRYLGWQQWTILAGLCALWFALIYVEGGRDYLYNILFKQTIGRG
VNSFHHKEPFWFYMPRMLWSFAPWSLLYVVLLWKGIQQKTINDDLKKFFLIVISTSLILL
SAISSKLDIYLLPEYPFIVYLCSIILMDNLNNKFVKIAITIPALLFALILPVIIAFGHEI
FAILNSPILLLAACIMLTFGGVVAIILLHKKQTLRAICVISFGIIGLVFIGSFIIPSVNK
YIGFREMASSALVLAKKKQVVHYACYKFNTASNMDVYLNSELQQTETVSQLDSMAHHWNK
TILFVRKKELLHDEELIKWIGRYSPVGKTGEYSWYLIEQKNSNSLVRLERKNVN

Enzyme Prediction     

No EC number prediction in MGYG000003064_00992.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	9	452	1.7e-66	0.8351851851851851

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.54e-21	18	437	27	446	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	1.69e-10	26	416	33	429	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam02366	PMT	0.009	45	214	52	225	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO50573.1	3.94e-128	4	525	5	519
QLK84536.1	2.09e-123	1	504	1	513
QTO25703.1	2.95e-123	1	504	1	513
QKH86812.1	1.18e-122	1	504	1	513
QUU03965.1	1.66e-122	1	501	1	502

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	1.23e-19	8	443	5	422	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
Q4ZSZ0	1.82e-15	25	313	33	319	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=arnT PE=3 SV=1
Q48HY9	2.22e-14	11	378	10	386	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) OX=264730 GN=arnT PE=3 SV=1
B2VBI7	2.11e-12	6	313	16	319	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99) OX=465817 GN=arnT PE=3 SV=1
Q8D339	4.97e-12	18	333	34	351	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Wigglesworthia glossinidia brevipalpis OX=36870 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.969937	0.029523	0.000325	0.000039	0.000048	0.000118

TMHMM  Annotations     

start	end
5	22
42	64
71	93
103	125
130	147
162	184
205	224
257	276
288	305
309	327
334	356
366	388
393	415