CAZyme Information: MGYG000003064_01297

Basic Information

• Species: Bacteroides graminisolvens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides graminisolvens
• CAZyme ID: MGYG000003064_01297
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376	MGYG000003064_4|CGC1	42805.93	6.9254

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003064	3410784	MAG	United States	North America

• Gene Location: Start: 132714; End: 133844 Strand: +

Full Sequence      

MKNKILFSFIVLAGMAVSSAMAQVLPSKQETLKTLTLVNSYFMKKYADYTLPSKTDRVRP
SNIWTRGVYYEGLMELYKIFPQEEYYQYAYGWSDFHKWGMRNGTTTRNADDQCCGQTYID
LYNICPTSPAMLKDIKACMDMLVNTPQVDDWTWIDAIQMGMPVLAKLGKLTGNTAYFDKM
WDMYAYSRNTHGGGLFNLKDGLWWRDADFVAPYKEPNGEDCYWSRGNGWVYAALVRVVNE
IPKNEKHRADYIKDFITMSKALKACQRSDGFWNVSLHDPSNFGGKETSGTALFVYGMAWG
INNGILNKAEYLPIALKAWDAMVKEAVHENGFLGYVQGTGKEPKDGQPVTYTNIPDFEDY
GIGCFLLAGTEIYKLK

Enzyme Prediction     

EC	3.2.1.172

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	57	374	3.9e-90	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.23e-109	38	376	5	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	7.20e-52	43	375	8	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ55827.1	1.09e-226	1	376	1	376
ALJ49019.1	1.17e-226	1	376	3	378
SCV08437.1	1.17e-226	1	376	3	378
QDH54529.1	4.94e-226	1	376	1	379
QUT27387.1	4.94e-226	1	376	1	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	1.63e-73	6	371	8	370	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	1.27e-66	62	371	37	353	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	4.18e-45	58	376	48	370	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	1.42e-15	56	375	31	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	5.89e-15	56	375	21	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL9	2.44e-46	64	376	58	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	2.67e-44	58	376	55	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	2.36e-38	108	372	135	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	7.78e-15	56	375	31	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000445	0.998729	0.000227	0.000209	0.000193	0.000176

TMHMM  Annotations     

start	end
5	27