CAZyme Information: MGYG000003064_01877

Basic Information

• Species: Bacteroides graminisolvens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides graminisolvens
• CAZyme ID: MGYG000003064_01877
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
847	MGYG000003064_6|CGC7	96969.92	6.2265

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003064	3410784	MAG	United States	North America

• Gene Location: Start: 192549; End: 195092 Strand: +

Full Sequence      

MKKLCSTFALLLFCLTTYAADQFVTFRKADGAFQIIGSGKVVNILLDEKDQKGIGIAVNN
LIEDFNRVCGMKPQLLKNTSSENCIIVGSLESTYIKQLIKAKKLDKKQLENKNEKFIITT
VNNPLQGVEKALVIAGSDRRGTIYGVYELAEQMGVSPWYWWMDVPVVKQTEAYVMPGVYT
DGEPAVKYRGIFLNDEAPCLTGWVKQHYGTDFGGHRFYSDVFELILRLKGNFLWPAMWSW
AFYGDDPLNSKTADEMGVVISTSHHEPMARNHQEWTRKRNEHGAWNYATNKKVLDQFFQE
GIERMKHTEDVVTIGMRGDGDAAMSDATNVKLLETVVENQRKIIQNVTGKPAKETPQVWA
LYKEVLDYYDKGMRVPDDVIMLLCDDNWGNVCRLPAEKERNRPGGWGLYYHVDYVGAPRN
TKWLNVTPIQGMWEQLHLAYEYGVEKLWVLNVGDLKPMEYPITLFLDMAWNPDAYTAENF
MKHPRKFCAQAFGEEQADEAARILNLYSKYNGRVTPEMLDAKTYNLETGEWKLVADDYAR
LEAEALRQYMSLAPEYRDAYKQLLLFPVQAMSNLYEMYYAQAMNHKLYAENNPMANHWAN
QVEKCFARDKALSYDYNNVMADGKWKNMMIQKHIGYTIWNDNFPADKLPEVFRIAEPEKA
VGGYVFTGKDGYVAMEAEHFFENKAPQGTEWKIIPDMGRFLSAVTLMPYTSPVNGASLSY
KMTLPQEAKGMKTVKVIVVVKSTLAFQDVKGHKYTVGFRGGNEETVNFNHNLNELPENVY
SVFYPTVARRVIEKEVTLELPVSEDGTYILDFKPLNPAVVLEKIVIDCGGYKKSYLYMNE
SSCERRQ

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	31	824	1.1e-280	0.9971305595408895

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	182	518	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	6.13e-33	665	836	1	168	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	7.67e-06	54	149	33	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EDY95690.1	0.0	10	845	10	843
QUR44901.1	0.0	1	845	1	842
QUT26893.1	0.0	1	845	1	842
QDH54071.1	0.0	1	845	1	842
CBK67960.1	0.0	1	845	12	853

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	0.0	1	845	12	853	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	0.0	33	845	17	838	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	0.0	33	845	16	837	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	4.28e-189	28	694	9	675	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	2.11e-124	47	642	25	648	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000251	0.999080	0.000148	0.000176	0.000157	0.000153

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003064_01877.