CAZyme Information: MGYG000003064_02192

Basic Information

• Species: Bacteroides graminisolvens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides graminisolvens
• CAZyme ID: MGYG000003064_02192
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303	MGYG000003064_9|CGC2	35046.8	9.9423

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003064	3410784	MAG	United States	North America

• Gene Location: Start: 77112; End: 78023 Strand: -

Full Sequence      

MNRKQSIRLILLVVLSAFAFSAQAQRRNQRYQEYIERYSPLAVEQMRVHKIPASITLAQG
LLESGAGYSELARKSNNHFGIKCGGRWNGPSVRHDDDARQECFRAYGNPVESYEDHSLFL
KRGARYAFLFDLDITDYKGWARGLKKAGYATDPSYANRLITIIEDYELYKYDRARQRGGA
YVPRVENRVINPHQVYLANDLAYVVARRGDTFESIGKEFDISARKLIRYNDLHKDYTLAD
GDVIYLHAKKKKASKNYIVHVVKDGDSMHSISQTYGIRLKNLYKMNRKDAEYVPEVGDRL
RLR

Enzyme Prediction     

No EC number prediction in MGYG000003064_02192.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	40	168	9.8e-34	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	2.07e-42	9	175	17	191	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	9.93e-40	32	172	161	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
smart00047	LYZ2	4.61e-31	28	172	5	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
TIGR02541	flagell_FlgJ	2.56e-26	3	163	120	290	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.
pfam01832	Glucosaminidase	1.79e-24	40	168	2	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDM08968.1	4.13e-164	8	303	7	301
CBK69423.1	4.13e-164	8	303	7	301
QUT80797.1	4.13e-164	8	303	7	301
QUT30108.1	4.13e-164	8	303	7	301
QRN00877.1	4.13e-164	8	303	7	301

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	2.09e-15	32	163	2	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	2.54e-15	32	163	3	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	1.75e-14	32	163	3	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5DN5_A	1.15e-11	51	164	23	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	1.52e-11	51	164	23	146	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37710	8.35e-19	14	286	165	457	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
O32083	9.21e-18	6	172	20	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	2.34e-12	32	167	161	306	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9I4P4	1.66e-11	33	170	241	389	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1
P58231	6.75e-11	51	164	169	292	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000253	0.999036	0.000227	0.000169	0.000152	0.000134

TMHMM  Annotations     

start	end
7	24