CAZyme Information: MGYG000003065_00412

Basic Information

• Species: Ruminococcus_B sp900544395
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Ruminococcus_B; Ruminococcus_B sp900544395
• CAZyme ID: MGYG000003065_00412
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	MGYG000003065_3|CGC2	42715.49	5.482

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003065	2628797	MAG	United States	North America

• Gene Location: Start: 52928; End: 54010 Strand: -

Full Sequence      

MKVKGVNLGNWLVLEKWMSSELFHGTEAEDEEDFYTMLSPEEAALRIRMHRDYFIQERDF
QHIRAMGLNLVRIPVPHFIFGDRAPYVGCVEYLDKAFDWAEQYDLKIMIDLHTVPDSQNG
FDNGGLTGVVKWHLKQENIEYTLDVLEKLAKRYADREGLYGIELLNEPVSKEVLEINKER
YRPRDPKRAEGSTYVPTEVLKEFYLKGYDRVCRHCGEHVKVVLHDGFRLEEWENFMPRES
YPNVVIDTHMYLNFSEAGIKGKHFSDYQKYVEESFEKRLVRAQQFHDVVVGEWCIANKSD
LIRSAAETEQKRRIYRMFGEMQLNAWEKCEGWIYWSYKLHTPGRNDWDFVRAVDEGWLVI

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	49	338	9.5e-114	0.9966887417218543

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	1.39e-27	2	338	17	363	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	7.81e-07	50	168	20	131	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCU02863.1	1.40e-129	1	358	1	385
QJU14366.1	6.53e-127	1	358	1	385
ANU75476.1	9.25e-127	1	358	1	385
QQQ93046.1	9.25e-127	1	358	1	385
ASU28285.1	9.25e-127	1	358	1	385

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	1.71e-121	1	358	1	386	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	1.39e-120	1	358	1	386	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
1CZ1_A	2.08e-48	3	356	9	376	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	2.38e-48	3	356	15	382	Exo-B-(1,3)-Glucanasefrom Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PBO_A	6.53e-48	3	356	15	382	ChainA, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5B5X8	1.73e-50	2	356	28	388	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
Q7Z9L3	1.73e-50	2	356	30	390	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
B8N151	1.73e-50	2	356	30	390	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
O93983	7.72e-50	2	351	41	406	Glucan 1,3-beta-glucosidase 2 OS=Wickerhamomyces anomalus OX=4927 GN=EXG2 PE=3 SV=1
Q12700	8.16e-48	2	356	41	408	Glucan 1,3-beta-glucosidase OS=Schwanniomyces occidentalis OX=27300 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003065_00412.