CAZyme Information: MGYG000003065_01731

Basic Information

• Species: Ruminococcus_B sp900544395
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Ruminococcus_B; Ruminococcus_B sp900544395
• CAZyme ID: MGYG000003065_01731
• CAZy Family: GH39
• CAZyme Description: HTH-type transcriptional activator RhaR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
799	MGYG000003065_24|CGC1	94428.72	6.4344

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003065	2628797	MAG	United States	North America

• Gene Location: Start: 9590; End: 11989 Strand: +

Full Sequence      

MSYHVQKAVSREENIQTELLVIFLLEGRMTLKYQDESYQMKAEDIILINPGVSYEIEGTR
DALYGIAAFSMHLLTAVLQSRYMIFYCNSVVDDSHSYQDLRDIFFQMTAEYALKAHQTNC
YLDSLMFKLLDCLVENYQLSQKRIEAYESENDARMREIMQYVLANLDQEISLNELAERMF
VSTSTLSRIFKKNTGVYFADYVMQLRVKTALGLLKYSQQNMTQIAMTSGFSNSASFNRAF
RKVMGITPTEYRDRYSRQNMGNEDAKEKQAIEIRAELKKKGYELGRQEKVTQIPLDMKTC
KGHKYHKTWNQMINIGPIWDLNKANVQFHTLQLNEQLHFKYFRIWNVFSKKMMINDGRTV
GQYNYDSINQVFDFLVQHRLKPFLDLGRRPDTALRSDGKEIFYEEQYIPFASRENWEMMM
DDFFCHIVERYGQEEVSGWIFELSRDCIHGDDISENRLYQDEQYDFFHAWNFLYQTVKSR
IPDARFGGVSSIITKDWKFLKQFLERCSLEHVKPDFVSFILFPYDSYPTDKVQVRKISQD
EQNEENQIREIRRLLDQVKMEELPIYITEMNHTISNRNYLNDSCFRAAYLVKKMEAIADQ
VEMIGIMSGTDWVSSHMDTVGIVNGGIGLLSKDTIRKPAYFAIDFLNQLGEYLLDKGENY
IVTRKESGDIYILCFYYSWFKRSYFLQEEDIDLRKHNSMVFKDESPLHLNFHFENLKESG
EYYLKKRTLNRKNGSILNEWGKFQYDIRLTRQDVKYLQGISFPTLSQSKAKVLQGENILD
MKVVLEPHEVSLIHIFCRQ

Enzyme Prediction     

No EC number prediction in MGYG000003065_01731.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	303	741	4.9e-53	0.9721577726218097

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2207	AraC	1.54e-27	150	257	17	124	AraC-type DNA-binding domain and AraC-containing proteins [Transcription].
pfam01229	Glyco_hydro_39	6.71e-27	332	795	38	487	Glycosyl hydrolases family 39.
COG3664	XynB	1.60e-26	323	796	3	425	Beta-xylosidase [Carbohydrate transport and metabolism].
smart00342	HTH_ARAC	7.23e-26	169	252	1	84	helix_turn_helix, arabinose operon control protein.
pfam12833	HTH_18	1.47e-24	175	254	1	81	Helix-turn-helix domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAK46391.1	2.91e-283	1	798	4	800
QQQ92191.1	9.26e-253	7	796	13	797
QJU15301.1	9.26e-253	7	796	13	797
ASU27451.1	1.06e-252	7	796	17	801
ANU74646.2	1.06e-252	7	796	17	801

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BS9_A	6.98e-35	304	795	13	480	Nativecrystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_B Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_C Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_D Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_E Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_F Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_G Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_H Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1W91_A	6.98e-35	304	795	13	480	crystalstructure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_B crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_C crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_D crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_E crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_F crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_G crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_H crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct]
2BFG_A	1.70e-34	304	795	13	480	crystalstructure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_B crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_C crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_D crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_E crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_F crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_G crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_H crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus]
4M29_A	5.71e-33	335	795	52	496	Structureof a GH39 Beta-xylosidase from Caulobacter crescentus [Caulobacter vibrioides CB15]
4EKJ_A	1.03e-32	335	795	52	496	ChainA, Beta-xylosidase [Caulobacter vibrioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZFM2	4.42e-32	304	795	13	481	Beta-xylosidase OS=Geobacillus stearothermophilus OX=1422 GN=xynB PE=1 SV=1
Q936F1	5.36e-28	19	765	23	712	Uncharacterized HTH-type transcriptional regulator OS=Staphylococcus aureus OX=1280 PE=4 SV=2
Q8NYT6	3.82e-27	19	765	23	712	Uncharacterized HTH-type transcriptional regulator MW0077 OS=Staphylococcus aureus (strain MW2) OX=196620 GN=MW0077 PE=4 SV=1
Q7A882	3.82e-27	19	765	23	712	Uncharacterized HTH-type transcriptional regulator SA0097 OS=Staphylococcus aureus (strain N315) OX=158879 GN=SA0097 PE=4 SV=1
Q99XB1	3.82e-27	19	765	23	712	Uncharacterized HTH-type transcriptional regulator SAV0101 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=SAV0101 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003065_01731.