CAZyme Information: MGYG000003067_01343

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000003067_01343
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
277		31596	5.2092

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003067	1773421	MAG	United States	North America

• Gene Location: Start: 1222; End: 2055 Strand: +

Full Sequence      

MDGLVVVCDIPRVIHYCWFGGNALGEKEVRCIESWKRFLPDCEIKRWDESNFDVRCCDYV
SEAYDAKKWAFVSDYARFKILNEEGGLYFDTDVEVVADMGDIIDAGPFLGIQADRPDSDD
ALPDFVPTVAPGLGMGSQPGSALYREVLDSYESGHFLLPDGSYDLMTVVDRTTNILRGHG
LRFVEGVQRVAGINIYPSEYFNPKDFWSGAITITSNTKSIHHFSMSWLSPRQIEEHQLVR
RLMERGCSLRFAYGVAKWYMTIRYVDVARVVRKLLKK

Enzyme Prediction     

No EC number prediction in MGYG000003067_01343.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	29	102	7.4e-20	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	5.37e-15	9	154	81	217	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	1.60e-10	25	109	1	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	4.32e-07	10	120	46	161	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFQ45980.1	5.53e-85	10	262	2	257
QUT53709.1	1.39e-83	10	263	2	257
QWT54350.1	1.04e-82	9	240	10	236
QIA43512.1	1.06e-81	10	245	6	229
ATP00764.1	1.06e-81	10	245	6	229

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003067_01343.