CAZyme Information: MGYG000003068_00204

Basic Information

• Species: UMGS1388 sp900551345
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales; UMGS1388; UMGS1388; UMGS1388 sp900551345
• CAZyme ID: MGYG000003068_00204
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
863		98745.88	4.1639

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003068	1753072	MAG	United States	North America

• Gene Location: Start: 6477; End: 9068 Strand: -

Full Sequence      

MVKKISVLLLILSICIQICPLNISDIVAQAAESSGPQQLHVEGNRLYNEDGEKVKLVGTC
ICSMEWAGGEHMETSFAMSMDNWNSNVIRLPLDTDGWWGTYWWVSDDGASYQRKVQNLVE
MATSRGKYVIIDLHHFGWIKEDDVKFWQEVVPQYKNNPGVLFNILNEPHTTGWDVWRNGG
YLNGERVYGQQELVEMIREMGARNMLVGSGLDWSYQLYAMVPGYDGLENGYQLEEPEGYE
GYGIMYDTHIYPWKGGEDSWAKMVGVAFPYIPVFSGEFGHTNERLADWFDDTYYEYATIW
NNQILNYYEQNEVNYNAWCFHNSSAPAALRNFDNYEPTPYDGLIVKFWLTYVEENNMPPL
EEREIVDEKPVYTWTNELDFDTKTVTPLVYKETDDTYIAVESRKGGIDDSNCQVIAFDIP
EGQENKAAAMFEMPQDWDNSGATFFTFRWRGDGDMRDMTFGVELKDGRQFSTTYPINLCK
NWQRQFYAVNALKGPYGLLDPNEIKYFYISPASAGKGSISIDDIVIGGVEPEEVTPVTYI
DDCETALTTWEAWADNENTRLDSFTVVNEPGSGVDGSSAYKFSFVRPEGSYGGQARAIFN
STWDLTNVKYFSFDIKGDGADHNLKFRLDRNIKDQKSNFYKREFERFCYDYKLTGSDWHH
VVIRIADFGMSETFEMEKLKKLQVYNMDPESSGTFYIDNLAFYTDYDMGLESEYKMHPDP
VPSEPVGELPYEYEDNIVYQFCNEEEGIAVSGGKVDDVTVGDIDANTTGTVTLTAGTKNY
LNFTLVNKTDEKVEGLLTIEGLPDGTVFEENGQYVPYTVVWREQNSVYFAFTPPSTAKGE
YKIRVIDTYAKGVEPKEYIVNIE

Enzyme Prediction     

No EC number prediction in MGYG000003068_00204.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	46	325	1.5e-32	0.850909090909091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	2.44e-24	47	324	1	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	3.88e-08	86	283	88	326	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam03425	CBM_11	0.001	537	704	4	174	Carbohydrate binding domain (family 11).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT50946.1	1.42e-212	15	858	7	841
QIF03557.1	1.59e-59	36	346	406	724
AMV22357.1	1.15e-56	36	346	412	730
AHF90980.1	1.16e-56	36	342	240	556
AHF92328.1	6.18e-51	36	346	230	548

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GJF_A	7.93e-16	38	279	12	230	Ancestralendocellulase Cel5A [synthetic construct],6GJF_B Ancestral endocellulase Cel5A [synthetic construct],6GJF_C Ancestral endocellulase Cel5A [synthetic construct],6GJF_D Ancestral endocellulase Cel5A [synthetic construct],6GJF_E Ancestral endocellulase Cel5A [synthetic construct],6GJF_F Ancestral endocellulase Cel5A [synthetic construct]
4XZW_A	9.07e-16	38	330	11	277	Endo-glucanasechimera C10 [uncultured bacterium]
1LF1_A	3.96e-14	38	329	11	274	CrystalStructure of Cel5 from Alkalophilic Bacillus sp. [Bacillus subtilis]
1A3H_A	8.70e-14	38	329	8	271	EndoglucanaseCel5a From Bacillus Agaradherans At 1.6a Resolution [Salipaludibacillus agaradhaerens],2A3H_A Cellobiose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 2.0 A Resolution [Salipaludibacillus agaradhaerens],3A3H_A Cellotriose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 1.6 A Resolution [Salipaludibacillus agaradhaerens]
1H11_A	9.02e-14	38	329	11	274	2-DEOXY-2-FLURO-B-D-CELLOTRIOSYL/ENZYMEINTERMEDIATE COMPLEX OF THE ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHEARANS AT 1.08 ANGSTROM RESOLUTION [Salipaludibacillus agaradhaerens],1H2J_A ENDOGLUCANASE CEL5A IN COMPLEX WITH UNHYDROLYSED AND COVALENTLY LINKED 2,4-DINITROPHENYL-2-DEOXY-2-FLUORO-CELLOBIOSIDE AT 1.15 A RESOLUTION [Salipaludibacillus agaradhaerens],1HF6_A ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHAERENS IN THE ORTHORHOMBIC CRYSTAL FORM IN COMPLEX WITH CELLOTRIOSE [Salipaludibacillus agaradhaerens],1OCQ_A COMPLEX OF THE ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHEARANS AT 1.08 ANGSTROM RESOLUTION with cellobio-derived isofagomine [Salipaludibacillus agaradhaerens],1W3K_A Endoglucanase Cel5a From Bacillus Agaradhaerens In Complex With Cellobio Derived-tetrahydrooxazine [Salipaludibacillus agaradhaerens],1W3L_A Endoglucanase Cel5a From Bacillus Agaradhaerens In Complex With Cellotri Derived-Tetrahydrooxazine [Salipaludibacillus agaradhaerens],4A3H_A 2',4' Dinitrophenyl-2-Deoxy-2-Fluro-B-D-Cellobioside Complex Of The Endoglucanase Cel5a From Bacillus Agaradhaerens At 1.6 A Resolution [Salipaludibacillus agaradhaerens],5A3H_A 2-Deoxy-2-Fluro-B-D-CellobiosylENZYME INTERMEDIATE COMPLEX Of The Endoglucanase Cel5a From Bacillus Agaradhearans At 1.8 Angstroms Resolution [Salipaludibacillus agaradhaerens],6A3H_A 2-Deoxy-2-Fluro-B-D-CellotriosylENZYME INTERMEDIATE COMPLEX OF THE Endoglucanase Cel5a From Bacillus Agaradhearans At 1.6 Angstrom Resolution [Salipaludibacillus agaradhaerens],7A3H_A Native Endoglucanase Cel5a Catalytic Core Domain At 0.95 Angstroms Resolution [Salipaludibacillus agaradhaerens],8A3H_A Cellobiose-derived imidazole complex of the endoglucanase cel5A from Bacillus agaradhaerens at 0.97 A resolution [Salipaludibacillus agaradhaerens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P22541	1.50e-15	38	301	115	370	Endoglucanase A OS=Butyrivibrio fibrisolvens OX=831 GN=celA PE=1 SV=1
P07983	1.48e-13	15	318	11	291	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
P10475	1.48e-13	15	279	11	259	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1
O85465	1.18e-12	38	329	37	300	Endoglucanase 5A OS=Salipaludibacillus agaradhaerens OX=76935 GN=cel5A PE=1 SV=1
Q59395	1.42e-12	21	257	25	236	Endoglucanase 6 OS=Pectobacterium parmentieri OX=1905730 GN=celV1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000237	0.999119	0.000165	0.000167	0.000147	0.000141

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003068_00204.