CAZyme Information: MGYG000003068_00639

Basic Information

• Species: UMGS1388 sp900551345
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales; UMGS1388; UMGS1388; UMGS1388 sp900551345
• CAZyme ID: MGYG000003068_00639
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
766		86904.64	5.5004

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003068	1753072	MAG	United States	North America

• Gene Location: Start: 2838; End: 5138 Strand: -

Full Sequence      

MLTAQNISDNKGETAESEGYFETGLMSPDNWEAEWIGSPKGNAGSISPILRKTFTAQNNI
ESARIYATAMGLYEIKFNGRKVGDMVLTPGFTSYEKHLLYQTYDITNMIKSGNNVIGITL
GKGWCLGRLGWGDWRQEGTFKNCTLGALMELHISYKDGTKEKIITDGSWKTYDSPILFSS
IYDGETYDARLENEWCNPDYDDKYWERVNIINYPKNHITAQENEPCRVIEEIKPYKIFKA
PNGENIIDFGQNLVGRVKLKVKGKKGNRVSYQHGEVLDKNGNFYSGNLRSAKQTVTYYLK
GGEEEFYTPYFTFQGFRYLRIIAFPGDFNKETFTAQVIHTDMDRTGYFECSDELVNKLFN
NVIWGQKGNFVDIPTDCPQRDERLGWTGDAQVFVQTAATNFNTAKFYSKWLKDMALDQRE
DGAVPYVIPHILDENDFGSSGWGDAATIVPWKLYLAYGDAQILNQQFDCMTKWVNYIRVQ
GDNEYLWDTGFHYGDWLGLDSAEGSYVGATSKQLIATAFYAYSVGITAKAAKVLGKDKEY
EKYSSLYKKVVDEFRNEFITPNGKVCDTTQTALCLALYFNLATDKKRAASELDKMIKENG
NKLKTGFLGTPYLCHCLSDNGYGETAYSLLLQREYPSWLYPVTKGATTIWEHWDGIKPDG
SFWSDEMNSFNHYAYGAIADWMYSAAAGIQYDEEKPGYKHIIIKPLVTNQLDYAKASVKT
VYGEVVSGWKRENGKISYEVKIPANTTATAYIDGQTYNLGSGKYKF

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	237	751	5.9e-178	0.996031746031746
CBM67	33	214	4.9e-35	0.9659090909090909

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	7.49e-145	343	685	1	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.40e-64	60	230	3	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	5.16e-27	239	339	2	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.08e-19	688	763	1	74	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS97620.1	1.14e-317	9	752	91	838
AUS97594.1	1.02e-315	7	752	89	839
QCT01496.1	1.04e-298	21	754	106	842
QJD88419.1	2.86e-298	9	754	94	846
BBI31680.1	2.77e-297	20	758	103	845

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	2.33e-181	33	752	285	994	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	3.85e-179	8	766	87	863	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	5.79e-149	21	752	135	898	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	9.00e-181	33	752	285	994	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	4.81e-179	9	748	127	874	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	2.42e-152	20	748	135	874	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	1.82e-105	20	765	135	946	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000017	0.000031	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003068_00639.