CAZyme Information: MGYG000003068_01352

Basic Information

• Species: UMGS1388 sp900551345
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales; UMGS1388; UMGS1388; UMGS1388 sp900551345
• CAZyme ID: MGYG000003068_01352
• CAZy Family: GT51
• CAZyme Description: Monofunctional glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
236		26821.69	4.516

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003068	1753072	MAG	United States	North America

• Gene Location: Start: 3023; End: 3733 Strand: +

Full Sequence      

MKLIKKVLIIALLLIAVIGAFEIYNGYSLYKETLSLSPLDEKVETITGKDNYIKKEDIPD
IYFKALVAVEDRRFYTHNGFDAIGTARAVINDIKAKKLLEGGSTITQQLAKNLYYPLDNS
LERKIAEVFTAFEIERNYSKDQILELYVNCVYYGSGYYSIHDAAMGYFNKSPSQMSDFEC
TLLVGIPNAPSVYSLDENPDLALERQVQVINSMVDCEYLTQEEADKILSLQQQMQQ

Enzyme Prediction     

No EC number prediction in MGYG000003068_01352.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	48	214	1.5e-57	0.9378531073446328

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	2.28e-71	52	214	15	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	1.02e-69	52	226	4	178	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	1.91e-64	1	226	2	243	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG0744	MrcB	4.04e-62	2	226	13	253	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
PRK13481	PRK13481	1.32e-45	2	229	6	230	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL05597.1	5.74e-78	24	227	8	211
QOS67703.1	3.17e-77	6	228	20	242
SET89048.1	2.47e-76	4	227	7	230
QRV21928.1	8.42e-75	29	227	1	199
ACV56467.1	2.39e-74	4	228	18	242

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	2.73e-41	52	229	22	199	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	5.44e-41	52	229	22	199	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	2.41e-34	41	229	48	242	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	2.62e-34	41	229	12	206	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	2.69e-34	41	229	13	207	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38050	2.33e-38	40	224	57	241	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
O87626	7.48e-38	31	228	47	246	Penicillin-binding protein 1A OS=Neisseria flavescens OX=484 GN=mrcA PE=3 SV=1
Q07259	8.69e-38	10	228	9	224	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2
P70997	1.03e-37	44	228	67	252	Penicillin-binding protein 2D OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpG PE=2 SV=3
O87579	1.90e-37	31	229	47	247	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.738438	0.247342	0.011800	0.000551	0.000346	0.001527

TMHMM  Annotations     

start	end
7	29