CAZyme Information: MGYG000003069_00466

Basic Information

• Species: Bifidobacterium gallinarum
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium gallinarum
• CAZyme ID: MGYG000003069_00466
• CAZy Family: GH13
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
748	MGYG000003069_3|CGC1	84175.55	4.6238

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003069	2149385	MAG	China	Asia

• Gene Location: Start: 120527; End: 122773 Strand: -

Full Sequence      

MTNNINEDIVAVPVNQGVLDSVSNAEFYNPHEVLGGHLGIGEHEDCVTVRVLRPLAKTVT
IVTQDGEYEASHEYNGVFMAVIPAVATETGHAVPDYRVRTCYEDGPTIVEDDPYRYLPTL
GEMDTYLFGEGRHERLWEALGAHVRRFDDPMGGADGTPGEQLVGTSFSVWAPNAHAVRVV
GNFNSWDGRRHAMRELGSSGVWELFIPGVQAGEIYKYQILNASGEWVMKADPMERSHEVP
PRTGSIVVESTHEWDDDAWMEHRRATNPHDGPVSIYEVHAGSWRQGLDYRGLADELVEYV
SKEGFTHVEFMPLAEHPFAGSWGYQVTGYYAVDSRQGGPDDFKYLVDKLHQAGIGVIMDW
VPAHFPKDGFALGRFDGTPLYEDPDPMRGEHPDWGTYVFNFGRREVRNFLVANACFWLDE
YHVDALRVDAVSSMLYLDYSREPGQWRPNIYGGRENLEAIDFLKEACATAYKNNPGIMMI
AEESTAYPGITAPTDAGGLGFGLKWNMGWMHDTLQYLHESPINRKWHHGEITFSMVYAYS
EHYVLPISHDEVVYGKGSLFGKMPGDDWQRYAGVRALFAYQWAHPGKNLTFMGNELAQYG
EWNHNASVDWDCLNWEEHRGVQRLVADLNALYKDSPALWSQDFDPAGFQWLTSDDADHNT
LSFMRVGKDGEQMVVVVNFSGNAWQDYQVPLPKGGRWREALTTDDAKYGGSDIHNGTFEA
VAGEYHSRDWSAKLTIPALGAVFLVPED

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	298	598	4.8e-155	0.9966777408637874

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12313	PRK12313	0.0	118	748	5	629	1,4-alpha-glucan branching protein GlgB.
PRK14706	PRK14706	0.0	133	746	9	621	glycogen branching enzyme; Provisional
PRK14705	PRK14705	0.0	10	746	499	1222	glycogen branching enzyme; Provisional
PRK12568	PRK12568	0.0	18	747	14	729	glycogen branching enzyme; Provisional
PRK05402	PRK05402	0.0	14	748	1	725	1,4-alpha-glucan branching protein GlgB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAY32746.1	0.0	1	748	1	748
BAQ31491.1	0.0	4	748	6	751
BAQ97939.1	0.0	4	748	6	751
AFL04325.1	0.0	4	748	6	751
AXM91849.1	0.0	4	748	6	751

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K1D_A	2.20e-280	28	746	19	721	Crystalstructure of glycogen branching enzyme synonym: 1,4-alpha-D-glucan:1,4-alpha-D-GLUCAN 6-glucosyl-transferase from mycobacterium tuberculosis H37RV [Mycobacterium tuberculosis H37Rv]
1M7X_A	6.38e-220	127	747	1	615	TheX-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_B The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_C The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_D The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli]
4LPC_A	3.49e-218	133	747	2	610	CrystalStructure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_B Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_C Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_D Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LQ1_A Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_B Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_C Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_D Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],5E6Y_A Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_B Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_C Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_D Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_A Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_B Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_C Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_D Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_A Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_B Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_C Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_D Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A]
5GQW_A	1.16e-217	28	744	39	771	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR1_A	3.27e-217	28	744	39	771	Crystalstructure of branching enzyme Y500A/D501A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142],5GR6_A Crystal structure of branching enzyme Y500A/D501A double mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8G5L0	0.0	12	748	1	737	1,4-alpha-glucan branching enzyme GlgB OS=Bifidobacterium longum (strain NCC 2705) OX=206672 GN=glgB PE=3 SV=1
Q47SE7	2.79e-307	19	745	34	745	1,4-alpha-glucan branching enzyme GlgB OS=Thermobifida fusca (strain YX) OX=269800 GN=glgB PE=3 SV=1
Q6AEU4	2.27e-302	7	744	6	729	1,4-alpha-glucan branching enzyme GlgB OS=Leifsonia xyli subsp. xyli (strain CTCB07) OX=281090 GN=glgB PE=3 SV=1
Q2J6Q9	4.58e-297	19	746	96	811	1,4-alpha-glucan branching enzyme GlgB OS=Frankia casuarinae (strain DSM 45818 / CECT 9043 / CcI3) OX=106370 GN=glgB PE=3 SV=1
Q0SGR9	1.19e-294	7	747	4	731	1,4-alpha-glucan branching enzyme GlgB OS=Rhodococcus jostii (strain RHA1) OX=101510 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003069_00466.