CAZyme Information: MGYG000003070_00957

Basic Information

• Species: QALR01 sp900542425
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; QALR01; QALR01 sp900542425
• CAZyme ID: MGYG000003070_00957
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
849		95109.12	6.3484

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003070	1834398	MAG	China	Asia

• Gene Location: Start: 17895; End: 20444 Strand: -

Full Sequence      

MKIRENSVRINGLVRPVIDSVPQFSWKLIANENGKRQDAYRIVVSASSDFASPIWDTGFV
TSEECSNIRYAGDPLLPMTRYYLSLTVRSEGELLSCMTEYFDTGKCGIPFSGIWITGHFC
LRRDEALAAPYLRRTFRAEKKIRRAMLYLAGLGYFEARINGEKVGNDFLSTAYTAYDKRI
LYRAFDVTNMLHIGGNALGVILGNGFYNCFTEDPWQSATAPWRDVPKLLCDLVLEYEDGT
RKTVKSDSTWKSHTGPITFNGIRHGETYDARLEMDGWDMPEFDDSDWKAPRRAANPGAEL
FVMEMEPIRIRKRFPAISKKKVPEGWLFDIGQNQAGVCLLTFRGKRGDKITVRYCDRLTE
DGRLDQAPLACFIKNYSFQTDTYIKRTDEPETWHARFTYHGYQWVEISGSREEPQLSDVT
ALSLCNDFAVRGEFFTSSETINKIQSMCLAATTSCCMNTFVSDTVREKSSWTGDTGLSVE
QLLINFAAEPLMKKWQQDLRDAERPCGSLPCIVPSPGWGYNGNLNGPDWSAPMWEVPWQI
YQSSGDLSVLRDNYSALCRFVSWLDSMSEDGIAYGGLGDWCAPFDGPAISVNMESFRCPV
AVTDTAYYYNAVMMAAASAELLGLPADVSKYKEKASYIRSAFRTRFYDEKTHTVSGNCQT
ATAVMIYYGLAKSAEIPALLNKLEEQIDACGGHLDFGVLGMKAVLNVLGIYGKTELALKM
IANPTYPSYAHWLTLGANTLWECWNGGGSRNHHMFSDVSAFFYKYIAGITAAAPGYRNVT
LRPAVNCGLEFVHATIDTPLGVILCEFRKKNGKTTLEIEIPVGCEATLSLPGTSAHTLHS
GRYHIQMQS

Enzyme Prediction     

No EC number prediction in MGYG000003070_00957.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	322	830	8.5e-130	0.9900793650793651
CBM67	125	298	1.2e-36	0.9147727272727273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.01e-76	432	766	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.15e-65	140	312	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.73e-26	320	422	1	99	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.38e-15	768	833	1	66	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	0.008	541	649	352	464	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ94103.1	6.92e-195	22	831	28	841
AHF16194.1	6.58e-174	2	832	20	863
AYB33152.1	1.55e-173	3	841	36	888
QDK77891.1	3.73e-165	13	848	38	878
SCD21043.1	4.58e-164	22	831	47	858

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	8.25e-134	22	831	51	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.65e-98	99	831	272	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	2.09e-65	19	846	20	866	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	9.46e-109	6	830	33	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	3.04e-105	19	838	52	886	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	7.32e-98	99	831	272	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	5.19e-95	12	831	39	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003070_00957.