CAZyme Information: MGYG000003070_01575

Basic Information

• Species: QALR01 sp900542425
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; QALR01; QALR01 sp900542425
• CAZyme ID: MGYG000003070_01575
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361		41601.39	4.5111

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003070	1834398	MAG	China	Asia

• Gene Location: Start: 9306; End: 10391 Strand: -

Full Sequence      

MNTKKRCFAARTWKTILLFLLIIVLIFVAGSGDMKKWVDTWFYPRLFDEYVEEYSAEYQI
EENMIYAIIKAESGFCQTAVSPSGAIGLMQVMPETYLSDIRENIGLDGDAEVLFEAKENI
QAGTYYYAKWYHYFGSSVEALAAYNAGIGNVEKWLADENLSTTSGLIIEKIPFKETRDYV
LRVLSYKTKYDELYGKKELPEKETVSEKLCYEWAVKYGEIYKMDPRFVMAIIKAESSFIP
SSVSPTGAVGMMQITKPTYETDIKANLKLEEDFEDLFDAEFNVKCGTYYLHWLDERLDGY
EQLAAAYNGGIGNVRDWLADPAYSTDGKTLIVENIPRDQTKRYVRKVMTFYEEYLARYPD
P

Enzyme Prediction     

No EC number prediction in MGYG000003070_01575.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	59	189	3.7e-27	0.8148148148148148
GH23	223	354	1.3e-25	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	2.57e-49	44	189	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	2.59e-45	216	352	10	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	2.12e-43	43	193	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd13401	Slt70-like	7.20e-37	209	357	4	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.30e-35	62	186	1	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNU68364.1	8.82e-34	18	198	14	192
ACL76418.1	2.63e-33	23	194	19	191
QEK21465.1	2.87e-33	14	198	4	184
QQQ87095.1	2.87e-33	14	198	4	184
ATW28310.1	8.94e-31	11	195	4	187

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1SLY_A	9.59e-17	43	197	449	605	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
1QSA_A	4.13e-16	43	197	449	605	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
5MPQ_A	3.10e-14	215	361	421	562	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	3.11e-14	215	361	425	566	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	3.14e-14	215	361	431	572	Lytictransglycosylase in action [Neisseria meningitidis MC58]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39434	2.24e-16	43	198	476	633	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC4	2.33e-15	43	197	476	632	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	2.33e-15	43	197	476	632	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
O31608	4.19e-14	48	185	61	177	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	6.08e-14	43	185	1418	1539	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998124	0.001685	0.000110	0.000004	0.000004	0.000095

TMHMM  Annotations     

start	end
7	29