CAZyme Information: MGYG000003072_00051

Basic Information

• Species: Paenibacillus amylolyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus amylolyticus
• CAZyme ID: MGYG000003072_00051
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356	MGYG000003072_1|CGC2	40184.88	4.6796

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003072	7042795	MAG	China	Asia

• Gene Location: Start: 54135; End: 55205 Strand: -

Full Sequence      

MLNQMVLQERISKVSQAMESMKNTSINEQFPIGLIDIHLWEWPQGVGLYGLLQLHEATKD
PKVLEFLESWYNARLMEGLPEKNVNTCAPLLTLISLCELTGNKEYEQVCEEWSSWIMDGL
LRTGDGAFQHMITGDANDGQILIDTLFMTVLFLAKAGVYFKKPDMVEEAKRQFLVHIKYL
YNKKTGLFYHGWDFNENHNYGAVHWGRGNAWYTAGVMDFLNIIPIEDGLKAYLLDTATAQ
VRALSKLQGEDGMWHTVLDDPTSYKETSATAAIGYGILKGIRYGYLDESYRQNGLSALEA
VLKQIDDHGVVQQVSYGTPVGQDAQFYKDIEISPMGYGQALTLFILIEGLRVPTAE

Enzyme Prediction     

No EC number prediction in MGYG000003072_00051.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	38	349	3.1e-100	0.9608433734939759

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	8.34e-102	40	351	34	351	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	3.48e-90	27	351	14	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZN73749.1	1.58e-266	1	356	1	356
APO45381.1	9.17e-266	3	356	3	356
QLG41208.1	1.77e-263	3	356	3	356
ANY67857.1	1.24e-238	1	356	1	356
AGX06452.1	8.06e-176	2	351	3	353

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	2.76e-87	40	351	65	378	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	3.20e-86	7	351	27	379	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	4.39e-84	38	351	45	370	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
4WU0_A	1.22e-26	40	304	23	301	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	2.55e-25	19	321	18	336	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	3.92e-54	40	351	29	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
O34559	1.39e-24	19	321	18	336	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003072_00051.