CAZyme Information: MGYG000003072_00456

Basic Information

• Species: Paenibacillus amylolyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus amylolyticus
• CAZyme ID: MGYG000003072_00456
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
561	MGYG000003072_1|CGC9	61621.91	7.4509

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003072	7042795	MAG	China	Asia

• Gene Location: Start: 470811; End: 472496 Strand: +

Full Sequence      

MKFKLKKTINVLLACLTALPLMLTPTNVSAASDANINLSSEKQLIKGFGGINLPAWIGDL
TPAQRETAFGNDQNQLGFSILRIYVDPDSNNWYREVATAKRAIEKGAIVFASPWNPPSSM
VETFNRNGDTNAKRLKYDKYTAYAQHLNDFVTYMKNNGVDLYAISVQNEPDYAHDWTWWT
PQEILRFMKENAGSIQGTKVMAPESFQYLKNISDPILNDPQALANMDILGAHTYGTQISN
FAYPLFKQKGAGKELWMTEVYVPNSDNNSADRWPEALDVSYHMHNAMVEGDFQAYVWWYI
RRQYGPMKEDGTISKRGYNMAHFSKFVRPGYLRVDATKNPDTNTFVSAYKGDNKVVVVAI
NRGTSATSQKFVLQNGNASTVSSWITDSSRNLASGTSLNVSNGAFTAQLPPQSVTTFVAN
VTGGNSGGNTGSGTTYEAETGTSLTEAAIETIYTGYTGSGYVNFNAMTGSAIQWNGINNT
TTGTKNVKFRYALESGTRNLDIFVNGTKVISNEPFPATGSWSTWVEKTIQVPMNTGTNTL
KVVTTGSEGPNIDSVNVTAAQ

Enzyme Prediction     

EC	3.2.1.8	3.2.1.136

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	33	377	2.2e-153	0.9912280701754386
CBM35	436	556	5.8e-25	0.9831932773109243

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5520	XynC	0.0	1	420	1	429	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
cd04082	CBM35_pectate_lyase-like	6.81e-43	436	557	3	124	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.
cd04083	CBM35_Lmo2446-like	3.36e-23	436	557	3	125	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
pfam03422	CBM_6	4.92e-22	437	559	1	125	Carbohydrate binding module (family 6).
cd04081	CBM35_galactosidase-like	2.72e-16	436	557	3	125	Carbohydrate Binding Module family 35 (CBM35); appended mainly to enzymes that bind alpha-D-galactose (CBM35-Gal), including glycoside hydrolase (GH) families GH27 and GH43. This family includes carbohydrate binding module family 35 (CBM35); these are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind alpha-D-galactose (CBM35-Gal), including glycoside hydrolase (GH) families GH27 and GH43. Examples of proteins which contain CBM35s belonging to this family includes the CBM35 of an exo-beta-1,3-galactanase from Phanerochaete chrysosporium 9 (Pc1,3Gal43A) which is appended to a GH43 domain, and the CBM35 domain of two bifunctional proteins with beta-L-arabinopyranosidase/alpha-D-galactopyranosidase activities from Fusarium oxysporum 12S, Foap1 and Foap2 (Fo/AP1 and Fo/AP2), that are appended to GH27 domains. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). Some CBM35s bind their ligands in a calcium-dependent manner. In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. GH43 includes beta-xylosidases and beta-xylanases, using aryl-glycosides as substrates, while family GH27 includes alpha-galactosidases, alpha-N-acetylgalactosaminidases, and isomaltodextranases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARQ79355.1	0.0	1	561	1	561
QZN73416.1	0.0	1	561	1	561
APO45061.1	0.0	2	561	5	564
AAB63573.1	0.0	2	561	5	564
QKS60404.1	0.0	1	560	1	560

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QAW_A	0.0	31	560	1	530	Structureof modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_B Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_C Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_D Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_E Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_F Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_G Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_H Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis]
3GTN_A	5.82e-237	31	420	2	390	CrystalStructure of XynC from Bacillus subtilis 168 [Bacillus subtilis],3GTN_B Crystal Structure of XynC from Bacillus subtilis 168 [Bacillus subtilis],3KL0_A Crystal structure of the glucuronoxylan xylanohydrolase XynC from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3KL0_B Crystal structure of the glucuronoxylan xylanohydrolase XynC from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3KL0_C Crystal structure of the glucuronoxylan xylanohydrolase XynC from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3KL0_D Crystal structure of the glucuronoxylan xylanohydrolase XynC from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3KL3_A Crystal structure of Ligand bound XynC [Bacillus subtilis subsp. subtilis str. 168],3KL3_B Crystal structure of Ligand bound XynC [Bacillus subtilis subsp. subtilis str. 168],3KL3_C Crystal structure of Ligand bound XynC [Bacillus subtilis subsp. subtilis str. 168],3KL3_D Crystal structure of Ligand bound XynC [Bacillus subtilis subsp. subtilis str. 168],3KL5_A Structure Analysis of a Xylanase From Glycosyl Hydrolase Family Thirty: Carbohydrate Ligand Complexes Reveal this Family of Enzymes Unique Mechanism of Substrate Specificity and Recognition [Bacillus subtilis],3KL5_B Structure Analysis of a Xylanase From Glycosyl Hydrolase Family Thirty: Carbohydrate Ligand Complexes Reveal this Family of Enzymes Unique Mechanism of Substrate Specificity and Recognition [Bacillus subtilis],3KL5_C Structure Analysis of a Xylanase From Glycosyl Hydrolase Family Thirty: Carbohydrate Ligand Complexes Reveal this Family of Enzymes Unique Mechanism of Substrate Specificity and Recognition [Bacillus subtilis],3KL5_D Structure Analysis of a Xylanase From Glycosyl Hydrolase Family Thirty: Carbohydrate Ligand Complexes Reveal this Family of Enzymes Unique Mechanism of Substrate Specificity and Recognition [Bacillus subtilis]
4UQA_A	2.23e-200	29	418	19	409	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus]
4CKQ_A	3.16e-200	29	418	19	409	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQ9_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQB_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQC_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQD_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQE_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus]
5A6L_A	2.57e-199	29	418	19	409	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],5A6M_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus ATCC 27405]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q45070	6.07e-244	4	420	4	421	Glucuronoxylanase XynC OS=Bacillus subtilis (strain 168) OX=224308 GN=xynC PE=1 SV=1
Q6YK37	7.19e-236	1	418	1	420	Glucuronoxylanase XynC OS=Bacillus subtilis OX=1423 GN=xynC PE=3 SV=2
Q56F26	6.37e-16	436	557	911	1032	Exo-beta-D-glucosaminidase OS=Amycolatopsis orientalis OX=31958 GN=csxA PE=1 SV=2
P23030	1.02e-11	437	557	166	288	Endo-1,4-beta-xylanase B OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=xynB PE=1 SV=2
P23031	1.05e-11	437	557	166	288	Alpha-L-arabinofuranosidase C OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=xynC PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000219	0.999107	0.000184	0.000179	0.000154	0.000141

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003072_00456.