CAZyme Information: MGYG000003072_00458

Basic Information

• Species: Paenibacillus amylolyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus amylolyticus
• CAZyme ID: MGYG000003072_00458
• CAZy Family: PL10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
317	MGYG000003072_1|CGC9	34912.91	10.1864

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003072	7042795	MAG	China	Asia

• Gene Location: Start: 472901; End: 473854 Strand: -

Full Sequence      

MKAKKIITFVLACTMVFSVVGMAVLPVGTVSAADASGTTASISDILKNQLPDGGWRKDYK
QTSGEWAKSTIDNKATYSEIRRLAKEFKKTNDPRYSTAAIKGINFLINMQYSNGGWPQVY
QSSGYHKHITYNDDAMINVMIMLDEVATRKGDFSFIDSTLANRSKNSVAKGVEAILNTQV
VSGGKLTAWGQQHDSSSLKPASARIYEVPSLTAGESVTIVKFLKTRPANAKITASIKGAE
AWFNKVKITGYKYERANGDSKIIADSKAAPIWARFYEIGTDKPIFIGRDGVVKYKLSDID
KERRGGYAWYGNWPSKL

Enzyme Prediction     

EC	4.2.2.2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL10	61	317	8.8e-102	0.9097222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09492	Pec_lyase	7.55e-122	49	317	1	288	Pectic acid lyase. Members of this family are isozymes of pectate lyase (EC:4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase.
TIGR02474	pec_lyase	8.70e-108	49	317	1	289	pectate lyase, PelA/Pel-15E family. Members of this family are isozymes of pectate lyase (EC 4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd02892	SQCY_1	5.01e-04	45	190	338	500	Squalene cyclase (SQCY) domain subgroup 1; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold. Squalene cyclase (SQCY) and 2,3-oxidosqualene cyclase (OSQCY) are integral membrane proteins that catalyze a cationic cyclization cascade converting linear triterpenes to fused ring compounds. This group contains bacterial SQCY which catalyzes the convertion of squalene to hopene or diplopterol and eukaryotic OSQCY which transforms the 2,3-epoxide of squalene to compounds such as, lanosterol in mammals and fungi or, cycloartenol in plants. Deletion of a single glycine residue of Alicyclobacillus acidocaldarius SQCY alters its substrate specificity into that of eukaryotic OSQCY. Both enzymes have a second minor domain, which forms an alpha-alpha barrel that is inserted into the major domain.
TIGR01787	squalene_cyclas	0.002	45	120	518	590	squalene/oxidosqualene cyclases. This family of enzymes catalyzes the cyclization of the triterpenes squalene or 2-3-oxidosqualene to a variety of products including hopene, lanosterol, cycloartenol, amyrin, lupeol, and isomultiflorenol.
PLN02993	PLN02993	0.003	45	129	599	671	lupeol synthase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZN73415.1	8.03e-229	1	317	1	317
APO45060.1	4.98e-226	1	317	4	320
QKS59541.1	7.72e-209	1	317	2	318
QOS78171.1	2.61e-198	8	317	10	319
QLG41555.1	2.93e-198	15	317	1	303

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1R76_A	5.63e-55	70	316	145	396	ChainA, pectate lyase [Niveispirillum irakense]
1GXM_A	7.17e-54	39	317	33	322	Family10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXM_B Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXN_A Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus]
1GXO_A	1.11e-52	39	317	33	322	MutantD189A of Family 10 polysaccharide lyase from Cellvibrio cellulosa in complex with trigalaturonic acid [Cellvibrio japonicus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000231	0.999137	0.000156	0.000170	0.000148	0.000133

TMHMM  Annotations     

start	end
7	29