CAZyme Information: MGYG000003072_01125

Basic Information

• Species: Paenibacillus amylolyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus amylolyticus
• CAZyme ID: MGYG000003072_01125
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370	MGYG000003072_3|CGC3	42100.62	5.5483

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003072	7042795	MAG	China	Asia

• Gene Location: Start: 195728; End: 196840 Strand: -

Full Sequence      

MQVQTQLSWSERIAATIIQQCDGDGYHAFPSGRWAYVEGMTLMAMARTGQYYGKQEYVDF
MKKHMDLYIQPDGSIGTYTLEEYNLDQINQGKNLFALLDGAEDQRYVEAAHLLAAQLAGQ
PRTSEGGFWHKKIYPFQMWLDGLYMSSPFLSEYAKTFHRPELWDEVAHQILLIERQTRDP
RTGLLYHGWDESKEQVWADSSTGCSPHFWSRAMGWYAMAIVDSVEHFPVNHPKRGTIIGI
FERMCHALVRVQEQESGLWFQVLDQGFRKGNYLEASGSSMFVYALAKGVRLRYLEPHFRV
AAEKGWQGLSSRLVEETADGVRLNGICHGAGLSLDRDGSYNYYVSEAVVSDSFMGVAPLL
LAALEMEQLP

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	31	368	1.6e-117	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	4.53e-109	30	369	30	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	2.06e-97	9	369	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZN76921.1	4.47e-280	1	370	1	370
APO42948.1	3.68e-279	1	370	1	370
QKS57662.1	2.07e-260	1	370	1	370
QLG37812.1	1.67e-250	1	370	1	370
QOS81753.1	1.94e-249	1	370	1	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	3.10e-112	34	369	23	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	4.25e-91	3	369	10	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	7.06e-90	7	369	4	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	3.96e-23	121	316	146	335	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	1.97e-20	121	337	147	353	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	2.33e-90	3	369	10	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	5.24e-38	145	365	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	5.24e-38	145	365	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003072_01125.