CAZyme Information: MGYG000003072_01241

Basic Information

• Species: Paenibacillus amylolyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus amylolyticus
• CAZyme ID: MGYG000003072_01241
• CAZy Family: GH88
• CAZyme Description: Unsaturated glucuronyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	MGYG000003072_4|CGC2	42091.29	5.8452

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003072	7042795	MAG	China	Asia

• Gene Location: Start: 22594; End: 23730 Strand: +

Full Sequence      

MNTSTSVKWLEEAWQQGVAKTIRNAKRIKDTFPHIAPQGTYDRNDPEWWTAGFWPGLLWL
VYEDAPESEAVAPLHRIAESCERQLEGCLRDPESVDHDLGFIWLLSGVANYRQTGSMDGR
RRGMLAANLLAARFHVRGEFIRAWNFSSSAMDTRGVAIIDSMMNLPLLYWASEQSGDPRF
RWLAEAHADTVAREFIRADGSICHVVEFDPHTGQKLREHGGQGHAPGSAWARGTAWALHG
FALSFRYTGEARYLETAERAADFFLAMLGEEIVPVWDFRAPAEHQVAWDSSAAAIAASGL
LELAKLSPRGETYAAAGERIVRGLHEHYSSGDSAAEEGLIMQGTVHYPEGRGLNVPIIYG
DYFYMEALAKLRGHAGLF

Enzyme Prediction     

No EC number prediction in MGYG000003072_01241.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	43	370	1e-111	0.9878419452887538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	9.57e-09	24	247	1	207	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZN77448.1	2.14e-282	1	378	1	378
APO43491.1	1.24e-281	1	378	1	378
QLG37311.1	2.96e-264	1	378	1	378
QOS76469.1	1.30e-263	1	378	3	380
QKS58122.1	1.13e-252	1	378	1	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1VD5_A	1.54e-73	14	376	2	370	CrystalStructure of Unsaturated Glucuronyl Hydrolase, Responsible for the Degradation of Glycosaminoglycan, from Bacillus sp. GL1 at 1.8 A Resolution [Bacillus sp. GL1],2D5J_A Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2D5J_B Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2FUZ_A UGL hexagonal crystal structure without glycine and DTT molecules [Bacillus sp. GL1]
2AHF_A	8.62e-73	14	376	2	370	ChainA, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHF_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_A Chain A, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1]
2ZZR_A	4.27e-51	10	370	28	388	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	4.37e-51	10	370	29	389	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3ANI_A	2.36e-50	10	370	29	389	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9RC92	8.46e-73	14	376	2	370	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
Q9A0T3	1.11e-52	24	370	44	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q8E372	2.39e-50	10	370	29	389	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q8DR77	3.38e-49	16	370	29	387	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
T2KLZ3	9.27e-43	49	370	77	393	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003072_01241.