CAZyme Information: MGYG000003072_01283

Basic Information

• Species: Paenibacillus amylolyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus amylolyticus
• CAZyme ID: MGYG000003072_01283
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
537	MGYG000003072_4|CGC3	58714.01	4.8571

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003072	7042795	MAG	China	Asia

• Gene Location: Start: 67180; End: 68793 Strand: +

Full Sequence      

MNTYHSPMSTGASAQSDVRAYEANLPVIPVQDFQLTDYGAVGDGVTDNTEMFRLAIASCA
EAGGGRIVIPAGVWLTGPIVMRSRIELHVEEGALVTFSRDFDQYPLIASSFEGWQVVRCQ
SPIDGDQLEDIAITGEGIWDGGGEAWRPVKRSKMTTSQWNQLIASGGVVEQSSGDEEIWW
PTTAALEGGAIANRLHQEQVRDVVAYEEVRDFLRPNMVSLRRCKRVLLDGPTFQNSPAWN
LHPWASEHVTIRNVSVRNPWFSQNGDGLDVESCRHVVVEKSVFDVGDDAICLKSGKDAEG
RELGLPSEYITIRDCTVYHGHGGFVIGSEMSGGVRHVRVSDCTFIGTDIGLRFKSARGRG
GVVEDIQIERIYMKDIIMEAISFSFFYANQEGSARGSDLSQEISEETPVFRDIRISDVVC
AGADTALLVSGLPEQPLDGVIIQRYNVQARSGIQCAHAKHLHIAELQAQITEGPLVHLHQ
CKGAELERIQGKGADGRLLMVTGHESAGIVCREGDADTDGRQISVGPEVRSGVIIRR

Enzyme Prediction     

No EC number prediction in MGYG000003072_01283.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	57	451	6.5e-80	0.9261538461538461

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	1.10e-90	33	441	83	470	Polygalacturonase [Carbohydrate transport and metabolism].
PLN03003	PLN03003	3.82e-18	35	376	26	291	Probable polygalacturonase At3g15720
pfam00295	Glyco_hydro_28	8.91e-18	130	376	25	239	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN02793	PLN02793	1.49e-15	33	376	53	330	Probable polygalacturonase
PLN02218	PLN02218	3.57e-13	35	448	70	409	polygalacturonase ADPG

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APO48071.1	0.0	8	537	1	530
QZN77483.1	0.0	1	537	1	537
QLG37272.1	0.0	1	537	1	537
QOS76498.1	0.0	1	537	1	537
QKS58204.1	0.0	1	537	1	537

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	1.19e-76	26	442	21	405	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
5OLP_A	6.47e-59	27	447	39	425	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
2UVE_A	3.96e-29	31	393	155	507	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]
1BHE_A	6.42e-15	49	438	26	353	ChainA, POLYGALACTURONASE [Pectobacterium carotovorum]
4MXN_A	4.33e-13	31	147	20	127	Crystalstructure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_B Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_C Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_D Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7PZL3	1.65e-48	35	447	65	424	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P27644	2.15e-33	223	436	30	249	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
P15922	1.08e-29	35	393	154	500	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1
Q9LW07	5.43e-20	35	395	26	310	Probable polygalacturonase At3g15720 OS=Arabidopsis thaliana OX=3702 GN=At3g15720 PE=3 SV=1
Q7M1E7	5.59e-18	33	452	59	405	Polygalacturonase OS=Chamaecyparis obtusa OX=13415 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000030	0.000015	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003072_01283.