CAZyme Information: MGYG000003072_02052

Basic Information

• Species: Paenibacillus amylolyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus amylolyticus
• CAZyme ID: MGYG000003072_02052
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1453		158819.92	4.5681

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003072	7042795	MAG	China	Asia

• Gene Location: Start: 46814; End: 51175 Strand: -

Full Sequence      

MNKRYISGCLVLLMLFCDLGLMVRPAAAEDAKVNVAFNKVVTVREEDLLNEGQKEKAVDG
DVNTHWSASSPTSESNPHWLTIDLGAPYDLSGAELTWKDKDQVVKYLIEVSDDGNNWSTV
VDQMTNEIKQTVASEEFQTNTPVQYVKVTIPYYAGANWWPGISELKVWGKEEKIDPATIT
SYDPVKVNTVAGVAPVLPTKVTAKYLNDKSGSVPVEWESIDPSEYAHAGSFTVTGAVYGA
PVQPEATVTVGGYRTDYVRGVDISTLTAIEANGGKYLDSNGTERDLLDILKDRGVNYVRL
RLWNDPQKSGGYNDKDDVIRLAERVKKKGMKILLDFHYSDEWAHPGQQLRPKAWEDLSPE
ELKQAVYNYTYEVVGEMKAKGAMPDMVQIGNEINSGVLNGLSSDVDFKQNVALLKSGIDA
VRAVEGEISNNADKVQIMIHLAEGGKADTFDWYFSELEKGELKYDIIGLSYYPFWHGTFA
DVQNTMNKVSDKFKKDVIIAETSYPFSYKNGDAHGNIIGSDEALHVGGATFPATVQGQYD
AIAGIMDMIADVPENRGAGFFYWEPAWIAANVGWIDSEGDAWENHAMFDYDEFPGNGGYS
YEGRALPSLDVYKRGLELLPADRQQLDAALTRAKSLVQTDFTLDSWVTLAPAISAANDVY
QQAYTPGGVTQLDTDAATTALERVMQQMQVITPQLDELRAKIAEARTYQQADWSAATWAV
LTKALEGADQILNDPRATQTDANTAVKRLHDAIQGLSNVDKTQLHQYIQQMQQQTKSSYT
RRSWSVLEQSLQAAIQVRDNNAVVQSEVNSALSTLKQAFTNLVSLEALTTGKTATASSSA
GTGGNQANSPEGAIDNNPNTSWGTDQSKDSWWQVDLGQVANLRKIEMSMWSGGIKYTIEV
SNDNKNFVKVVDTTSDVVVSTAPSHVLPEGTEGRYIRVTIKTGPTWVGFMEFEAYGTFPA
DKSALQTTVDTAEKLKQTEYTTSSWNVFSKALSEAKAFILDVESSTQDVSNADRALQDAV
SKLVRQDVTPGPGQPSQPSNPGTAPSTGNPAVTLPVEPGNPPVKGLITVKGTETGNDKYS
IRPDVSQLTQALQSMDAGNRTLKLLADVPDTAKTVTFQLAASQLAAWIRSEEVQSLDVVV
GQTTVRVPLRSLPLTIAETEGTFDIVVAKGSTDTLTTSQKAAIGNHAIVDVNLLMNNKPL
QWTNRAVEVALSNVEQPKKNDVVMVVHSISTSGEMKPVTYSKYDDKTKTITFKPLESSGY
VIAEVEVPLNDLQNHNWALQEVQNLYGKGIITGMSATRFAPQGELTRAQFLQMIVKGIGD
TRQPDPSISVPTDVKEGQWYADSVRLGIEMNIIQGRADGSFGANERISREDMAVMLNRAL
KVVQHDQDATNAVQGNMVFVDNAEIAAYAKEAVASMQQLGLLNGMPDGTFAPKETANRAQ
GAVAVARLMEQLY

Enzyme Prediction     

No EC number prediction in MGYG000003072_02052.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	258	592	6.3e-124	0.9707602339181286
CBM32	51	165	8.6e-25	0.8548387096774194
CBM32	834	951	4.4e-20	0.9596774193548387

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07745	Glyco_hydro_53	2.08e-127	259	612	2	333	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
COG3867	GanB	4.86e-117	234	613	16	392	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].
pfam00754	F5_F8_type_C	6.30e-21	46	165	6	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam00754	F5_F8_type_C	1.30e-16	833	949	1	121	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam07532	Big_4	5.01e-10	183	239	2	58	Bacterial Ig-like domain (group 4). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in a variety of bacterial surface proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZN74904.1	0.0	1	1453	1	1458
APO46445.1	0.0	1	1453	1	1458
QLG39806.1	0.0	1	1453	1	1451
QOS79802.1	0.0	1	1453	1	1450
QKS55644.1	0.0	1	1453	1	1458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7OSK_A	2.98e-87	250	627	43	406	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
1R8L_A	9.45e-76	226	613	1	389	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]
2GFT_A	6.02e-75	226	613	1	389	ChainA, Glycosyl Hydrolase Family 53 [Bacillus licheniformis],2GFT_B Chain B, Glycosyl Hydrolase Family 53 [Bacillus licheniformis]
1HJS_A	4.16e-47	259	614	5	331	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
1FHL_A	2.02e-46	259	590	5	319	CrystalStructure Of Beta-1,4-galactanase From Aspergillus Aculeatus At 293k [Aspergillus aculeatus],1FOB_A Crystal Structure Of Beta-1,4-galactanase From Aspergillus Aculeatus At 100k [Aspergillus aculeatus],6Q3R_A ASPERGILLUS ACULEATUS GALACTANASE [Aspergillus aculeatus],6Q3R_B ASPERGILLUS ACULEATUS GALACTANASE [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48843	3.28e-84	257	632	6	366	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
Q65CX5	1.07e-74	250	613	42	414	Endo-beta-1,4-galactanase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ganB PE=1 SV=1
O07013	2.28e-66	250	613	46	418	Endo-beta-1,4-galactanase OS=Bacillus subtilis (strain 168) OX=224308 GN=ganB PE=1 SV=1
P48841	4.30e-56	254	589	24	351	Arabinogalactan endo-beta-1,4-galactanase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=ganB PE=1 SV=1
P83692	2.28e-46	259	614	5	331	Arabinogalactan endo-beta-1,4-galactanase OS=Thermothelomyces thermophilus OX=78579 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000386	0.998354	0.000739	0.000178	0.000161	0.000153

TMHMM  Annotations     

start	end
5	27