CAZyme Information: MGYG000003072_03728

Basic Information

• Species: Paenibacillus amylolyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus amylolyticus
• CAZyme ID: MGYG000003072_03728
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
813	MGYG000003072_16|CGC4	90744.13	4.6617

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003072	7042795	MAG	China	Asia

• Gene Location: Start: 111189; End: 113630 Strand: -

Full Sequence      

MIKTSFNADWLVGSKPGLFGEWVTDKKPHKLVTLPYDAMWANERLKDGRGTIACYPEGEY
EYKKSFFVPEEYRNKRVTFEFEGVYNQAMVYINGDFAGQHPYGYSNFYIKADRFLKYGQK
NEISVIANNYKDSRWYSGAGIYRNTKMIIGNLAHVALDGVKITTPEVSADRAVVKVKTVI
ENEGLSTLTVQLLTEIIGADGTVVASDLVPVTTFAGELSTIRQSMLVKAPKLWNVDEPNL
YTCRTTVTSDDEVDQELTTFGIRTLTLDTDQGLCINGKVVKLRGACIHHDNGVIGAATID
RAEERRVEILKESGFNALRSAHHPISKALLDACDRIGMLVMDESFDMWSSVKTDYDYAMS
FPVWWEKDVQAMVDKDFNHPSVIMYSIGNEIPEAGSSIGSIWGRKISEKIHTLDPTRFTT
NSVSFLLTVIKDLPNMMGVESETHHASDNSEAAGINTTMNNLGDALAAIIDGEICTERTA
ESFAYVDIAGYNYAESRYLKDIERFPNRIIVGSETFPNKINVNWNFVKEHSQIIGDFTWT
GWDYLGEAGIGRVHYDIEGPTHLIQSTYPWISGWCGDIDIIGNRRPVSYYREIVFGLRKA
PYIAVQRPEHYSKEVNLSDWSWSDSVSSWSWTGYENKPIKVEVYSDAEEVELLINGRTIG
KTDMSEKQDFIAEFDTVYESGEIIAVAYVGGQEVGRMSIHSAKGDVILKAAADRTEINAS
DSDLAFVMISLEDEQGNLYNTADREVKLMIEGPGHIQGFGSANPVTEENFFNEEYTTFDG
KALAVVRPTGAGTIILTVAAEGCIPQSVRINAV

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	5	617	5.4e-94	0.6117021276595744

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	9.99e-51	62	420	85	439	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	7.53e-35	58	428	65	453	beta-D-glucuronidase; Provisional
pfam18565	Glyco_hydro2_C5	1.31e-32	708	809	1	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
PRK10340	ebgA	1.20e-30	62	417	113	470	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	4.12e-22	62	390	124	462	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHC17900.1	0.0	1	812	1	808
APB78082.1	0.0	1	812	1	808
AIQ16647.1	0.0	1	812	1	811
AET61101.1	0.0	1	813	1	808
QZN73691.1	0.0	1	812	1	817

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B6L_A	5.87e-148	3	811	7	776	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	8.99e-148	3	811	7	776	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
7CWD_A	1.37e-110	32	810	36	799	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4YPJ_A	1.84e-108	3	787	9	781	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
5T98_A	7.50e-104	5	811	29	819	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	4.16e-101	3	812	44	848	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	5.57e-72	2	787	47	794	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
P77989	3.87e-42	5	768	7	702	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KPJ7	5.26e-33	14	660	52	673	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P26257	4.05e-29	28	758	36	706	Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=lacZ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003072_03728.