CAZyme Information: MGYG000003072_04139

Basic Information

• Species: Paenibacillus amylolyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus amylolyticus
• CAZyme ID: MGYG000003072_04139
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
753	MGYG000003072_19|CGC4	81688.17	6.6174

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003072	7042795	MAG	China	Asia

• Gene Location: Start: 111440; End: 113701 Strand: +

Full Sequence      

MHVKWMTIIGAVVGSMLIGVGTAPAEETFVDLKYSKWAEDGITYMAKRGTVAGYGNGTFK
PEALVTRAQAVTFMVRELYSDQLQRAVEGTTYSDVPTTHPFHREIMIAAKNGLASGFPNG
TFRPDAPLSRAETAAFLTRAYALVEGKNAAKWTDTDRHWAAAPILIMSSNGLVGGYSDAT
FRPNQAVTRAEYAVFMARVIRFEREAAIRTQDWDKLISYMTVSEQVGQMLMPDIRQWNGK
ATTTVNEGLKRTIHDQDLGGLILFDKNIVDVTQLTTFTHDIQREAGDIPLFLSIDQEGGV
IKRIPGGTNLPGQMALGATGDATLAETAGQLTGEELKALGLQINFAPVLDINSNPDNPII
GIRSFGSEADLVTRLGLATIKGLQQSGVMAAVKHFPGHGDTTVDSHLGMPVLAHNRERLD
AVELKPFRAAIENGVEMIMTAHIAFPAIDNEHVTSLKDGERVPIPATLSKKVLTGLLRGE
LGYEGLIVSDAFTMNAIAEHFGENQSVERAVTAGIDIILMPKNSAAAHQTLVNAVNNGTI
KDETIHASVKRILEIKAKYGLFERSQTLAQKLTQLNGIIGSKAHRAVEQTIAERAVTVLS
SREGVLPDPIQQGDRVVIVAAEQEQAKQLEKQLLQAANNLSLKTEISLVGQGNMNETLQA
IGKANYVILASYQFRNVASQFGWSDYQTLINAMNKSNQRYTLLSLGNPYETIYLQNVRSG
IAVYGKQEPNTSAGIKVLLGQLKAGGQLSVLTD

Enzyme Prediction     

No EC number prediction in MGYG000003072_04139.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	286	520	3.1e-66	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	9.04e-102	220	619	1	360	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	8.23e-96	221	555	1	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	1.08e-52	259	577	27	334	beta-hexosaminidase; Provisional
NF033190	inl_like_NEAT_1	4.23e-20	10	201	561	753	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.
PRK15098	PRK15098	1.78e-19	214	607	39	406	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APO45876.1	0.0	1	753	1	753
QZN74270.1	0.0	1	753	1	753
QLG40145.1	0.0	1	753	1	754
QOS79125.1	0.0	1	753	1	753
QKS48662.1	0.0	2	753	9	756

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4GYJ_A	1.60e-140	187	750	15	619	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
3BMX_A	1.88e-140	203	750	25	615	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.88e-139	206	750	2	589	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
6K5J_A	1.37e-93	220	748	11	527	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
4ZM6_A	7.28e-73	222	750	9	525	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	1.03e-139	203	750	25	615	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	5.98e-80	220	753	16	597	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q7WUL3	7.39e-48	249	618	51	408	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
Q0AF74	3.54e-41	241	533	11	295	Beta-hexosaminidase OS=Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57) OX=335283 GN=nagZ PE=3 SV=1
A9M1Z4	3.11e-40	241	520	16	288	Beta-hexosaminidase OS=Neisseria meningitidis serogroup C (strain 053442) OX=374833 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000349	0.998956	0.000219	0.000159	0.000153	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003072_04139.