CAZyme Information: MGYG000003072_04781

Basic Information

• Species: Paenibacillus amylolyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus amylolyticus
• CAZyme ID: MGYG000003072_04781
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
770	MGYG000003072_25|CGC2	84615.42	4.7242

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003072	7042795	MAG	China	Asia

• Gene Location: Start: 38201; End: 40513 Strand: -

Full Sequence      

MDYKDASLPIQERVQDLIGRMTTAEKIGQLIQPMGWKTYDKAADGTVQVTEEFKADMEQG
GVGSLYGVLRADPWTEVTLETGLTPRQGAVATNVIQQYAMEHSRLGIPILFGEECSHGHM
AIGATVFPVPLMVGSTWNMELYRKMCEAIAVETRSQGGAATYSPVLDVVRDPRWGRTEEC
FAEDPYLIGEFAVEAMKGLQGDRLDSNQTIVATLKHFAAYGSSEGGRNAAPVHMGLRELH
EIDLLPFKKAVEAGACSVMTAYNEIDGVPCTSSTYLLNDLLREQWGFEGFVITDFGAIQM
LVHGHNTAENGEQAVAQSLQAGVDMEMSGYMYRKHLGQALEQGLIKEKDLDLAVWRVLEM
KFRLGLFEKPFVDPEFAERVIGCEDHIQLAREVAQEGIVLLKNEGNTLPLAKTGTMLAVI
GPNANHIYNQLGDYTSPQPREQIVTVLDGITRKLGVDSGQVLYAPGCRIKGDSREGFAQA
LACAEQADVIVMVMGGSSARDFGEGTIDLRTGASVVTDDPWNDMECGEGIDRASLNLMGV
QLELVQEVHKLGKPVIVVYINGRPIAEPWIDEHVHAIVEAWYPGQEGGNAIADILFGDVN
PSGRLTVSIPKHVGQLPVYYHAKRTRGKRYLEMDLAPQYPFGYGLSYTEFKYENVRVMPE
IIGPDDEAQVMVEVTNTGAVAGSEVVQLYITDVSASVTRAEMSLKGFRKIHLKPGQTQTV
TFPVQKEHLALIDSRLQSVVEPGEFRLMVGRNSMDWTACSLHIQKVGVEV

Enzyme Prediction     

No EC number prediction in MGYG000003072_04781.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	100	327	1.3e-72	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	6	755	27	756	beta-glucosidase BglX.
COG1472	BglX	8.88e-99	21	452	1	393	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	2.14e-93	5	750	44	769	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	9.32e-80	22	360	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	3.78e-77	398	647	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZN77313.1	0.0	1	770	1	770
APO43401.1	0.0	1	770	1	770
QOS82159.1	0.0	1	769	1	769
QLG37400.1	0.0	1	770	1	770
QKS60225.1	0.0	1	770	1	770

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z87_A	3.21e-158	2	755	35	776	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	3.26e-154	14	755	14	743	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	1.81e-153	14	755	14	743	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	1.46e-149	14	753	13	740	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5YOT_A	2.90e-146	3	755	7	747	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	4.99e-149	97	753	55	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q56078	3.15e-145	14	753	38	754	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	1.74e-144	14	753	38	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	3.50e-129	2	765	28	756	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	3.67e-101	10	755	35	767	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003072_04781.