CAZyme Information: MGYG000003072_04892

Basic Information

• Species: Paenibacillus amylolyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus amylolyticus
• CAZyme ID: MGYG000003072_04892
• CAZy Family: GH48
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1091	MGYG000003072_26|CGC3	118506.48	4.3721

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003072	7042795	MAG	China	Asia

• Gene Location: Start: 67760; End: 71035 Strand: -

Full Sequence      

MLKSAAKKSLTAMLAGTVMLTGYTGLWAGPQTAHAADQAIEIQADGINEARFLQLYDQLK
DPANGYFSPEGLPYHSIETLLSEAPDYGHMTTSEAYSYWLWLETMYGHYTGDWSQLEAAW
DSMEKYIIPVNEGDGKEEQPTMSSYNPNSPATYAAEKPFPDQYPSPLNGQYAAGKDPIDA
ELKATYGDNQTYLMHWLVDVDDWYGYGNLLNPSHTATYVNTFQRGEQESVWEAIPHPSQD
DKSFGKANEGFMSLFTKETQVPSAQWRYTNATDADARAVQVLYWAKEMGYNNPEYLDKAK
KMGDYLRYGMYDKYFQKIGSAKSGTPTPGTGKDSNMYLMAWYTSWGGGLGQGGDWAWRIG
ASHTHQAYQNPVAAYALSDPAGGLIPESATAKADWNATLKRQLEFYTWLQSHEGAIGGGA
TNSLDGSYKAYPAGVSTFYDMAYQEAPVYRDPDSNTWFGFQAWPLERVAEMYYILAESGD
LTSENFQMAKKVITKWIDWSKDYVFVGERPVTDAQGYYLNAAGQRILGGTNVQVATTPAP
GEFWIPGGQEWQGQPDKWNGFSSFTENPNFRVTTKDPVQDTGVLGSYVKALTFFAAGTQA
ENGTLSAEGQEAKDLAEALLDTAWDYNDGVGIVTEEERKDYFRFFAKEIYIPANWSGTFG
QGNTIPGTAGVPSDPAKGGNGVYIGYSDLRPAIKQDPAWAYLDNLYKTSYNTTTKQWENG
APTFTYHRFWSQVDMATAYGEYDRLLGDSDSPEVEVPAAPAGVTATGGSEQVVLNWNAAA
GAASYNVKRAEVNGGPYTSVATGVTGSTFTDTGLTNGTTYYYVITAVNAVGESAPSTQAS
ATPLAGTVVPGVFNLTGTAGDAQAVLTWTASTGATSYKVQRSVGTGAYADLATGLTALTY
TDATAVNGTAYNYRVVAINTSGQTNSNVLVLTPLAPPVTTGTLEVQYRNGSSGASVNAIT
PQFNVKNTGTTAVDLSKVKVRYYFTKDSAADLSFWCDYAQIGSGNVEGHFVSIDPAKGTA
DTYLEIEFKAGAGSLAAGAETGIIQGRFSKNNWTNFDQTNDYSFDSTQSAFSAWTKVTAY
QDGAKVWGIEP

Enzyme Prediction     

EC	3.2.1.176	3.2.1.4	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH48	50	508	4.4e-205	0.7332242225859247
CBM3	946	1026	1.6e-27	0.9772727272727273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02011	Glyco_hydro_48	0.0	49	745	2	619	Glycosyl hydrolase family 48. Members of this family are endoglucanase EC:3.2.1.4 and exoglucanase EC:3.2.1.91 enzymes that cleave cellulose or related substrate.
pfam00942	CBM_3	3.26e-28	945	1026	1	82	Cellulose binding domain.
smart01067	CBM_3	4.21e-25	945	1026	1	82	Cellulose binding domain.
cd00063	FN3	5.77e-10	757	842	1	92	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
smart00060	FN3	2.43e-06	757	833	1	83	Fibronectin type 3 domain. One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APO44259.1	0.0	1	1091	1	1091
QZN78193.1	0.0	1	1091	1	1091
QLG42359.1	0.0	1	1091	1	1091
QKS58746.1	0.0	1	1091	1	1091
CAD32945.1	0.0	1	1091	1	1091

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7KW6_A	0.0	48	749	3	704	ChainA, Exoglucanase-2 [Bacillus licheniformis]
5BV9_A	0.0	48	746	3	700	TheStructure of Bacillus pumilus GH48 in complex with cellobiose [Bacillus pumilus SAFR-032],5CVY_A The Structure of Bacillus pumilus GH48 in complex with cellobiose and cellohexaose [Bacillus pumilus SAFR-032],5VMA_A Structure of B. pumilus GH48 in complex with a cellobio-derived isofagomine [Bacillus pumilus]
6D5D_A	1.29e-211	51	748	23	644	Structureof Caldicellulosiruptor danielii GH48 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii]
4L0G_A	8.31e-210	51	759	16	648	CrystalStructure of a GH48 cellobiohydrolase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii DSM 6725],4L6X_A Crystal Structure of a GH48 cellobiohydrolase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii DSM 6725],4TXT_A Crystal Structure of a GH48 cellobiohydrolase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii DSM 6725]
4EL8_A	4.39e-209	51	748	12	633	Theunliganded structure of C.bescii CelA GH48 module [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P50900	2.80e-237	44	1091	36	914	Exoglucanase-2 OS=Thermoclostridium stercorarium (strain ATCC 35414 / DSM 8532 / NCIMB 11754) OX=1121335 GN=celY PE=1 SV=2
P50899	2.46e-210	4	926	13	875	Exoglucanase B OS=Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / NBRC 15513 / NCIMB 8980 / NCTC 7547) OX=590998 GN=cbhB PE=1 SV=1
A3DH67	5.80e-201	30	761	22	673	Cellulose 1,4-beta-cellobiosidase (reducing end) CelS OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celS PE=1 SV=1
P0C2S5	5.80e-201	30	761	22	673	Cellulose 1,4-beta-cellobiosidase (reducing end) CelS OS=Acetivibrio thermocellus OX=1515 GN=celS PE=1 SV=1
P22534	1.08e-197	51	748	1120	1741	Endoglucanase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000472	0.998605	0.000248	0.000288	0.000193	0.000161

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003072_04892.