CAZyme Information: MGYG000003072_06180

Basic Information

• Species: Paenibacillus amylolyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus amylolyticus
• CAZyme ID: MGYG000003072_06180
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
747	MGYG000003072_50|CGC1	84767.19	5.0228

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003072	7042795	MAG	China	Asia

• Gene Location: Start: 8201; End: 10444 Strand: +

Full Sequence      

MTTYFSEPQSMYYRFGEDQDQVLKVLAERYIGANAQADFVYRVFQKSGILQNEKGLYDLN
LGKRFPDAPKDHISYAAALVWGDEDRNLDVLVRCYGPVRFYFNEQLVYRSTVMDEISPDA
TVKLSIDIKPGWNTIWLEMKNTPAGFGCQFGSDEGKVRILNVYAPFQERQGQAGWVFSQP
NPATSKQPDLLGKESDVSLNWLPETGWSDEDKTKPAFERIYGNLAGKHAYAWTHLNNNDS
TGNAVRLSGQSSGSLSIWISGKPVAQVKEAGPFEVDVPASFGRSDLLVRSEYDDTAGPWH
FNLNATVSGKPLSLELPQRVHGANGESWLYVGPFESEVEPDLADLTRTDRVYQTGLEQTY
WRLDRPDAWIRPYYENAMLSNKWTVGSVTNYGRWDYPLGVTVYGLLRTGRYLQRPDITRY
AAEHVQACTQMYEYSLWDREQYGFPAVNQQLVMLKMLDNCGSFGSAMLEAYSECHEPTFL
PIAERIADFMLSRLERQEDGAFYRTCVGEYAENTMWADDLYMSTPFLVRYARVTGNSAAL
DEAARQFSLYRKYLFMPEFKIMSHVYDFKYGQATQIPWGRGNGWTLFSLTEVLEALPAEH
PERPALIDFFNELCEGYAALQGESGLWHQVLNVPQTYEEASCTAMFAYGFARGVRFGWFK
DPEVYVTAAERAWKGLICKAIDRQGSVHGVCSGSRYAFTAEYYDQDLRTVTNDNHGIGIM
MLAGTEVAKMKKHLAEHRVSSPAVSHS

Enzyme Prediction     

No EC number prediction in MGYG000003072_06180.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	390	728	1.4e-91	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	8.61e-63	380	731	13	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.18e-50	392	729	32	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APO43433.1	0.0	1	747	1	747
QZN78692.1	0.0	1	747	1	747
QKS58072.1	0.0	1	747	1	752
QOS82185.1	0.0	1	747	1	780
QLG37373.1	0.0	1	747	1	750

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	7.40e-33	450	730	137	413	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	2.03e-25	379	727	24	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	7.72e-25	379	727	14	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	3.99e-21	471	703	122	354	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4WU0_A	1.93e-19	515	726	127	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.11e-24	379	727	24	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
O31521	2.05e-22	394	734	29	342	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
P9WF04	3.30e-18	516	727	201	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
L7P9J4	1.03e-16	516	731	161	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003072_06180.