CAZyme Information: MGYG000003073_01161

Basic Information

• Species: Collinsella sp002232035
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp002232035
• CAZyme ID: MGYG000003073_01161
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324	MGYG000003073_67|CGC1	35496.61	4.8978

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003073	1983892	MAG	China	Asia

• Gene Location: Start: 9456; End: 10430 Strand: -

Full Sequence      

MAEPERKTLVVDESGHGDYRTLTEAVAACAETPELPVRFFIRHGIYEERPFIELADYIIE
GEYRNATIITASVGGRDPWPGEAKTGTFRSETLFLGGGRAVVRNLTIQNNAGDGANAGQA
LAVYADASRVLMEDVNLYGNQDTLFTAPLPLQEREKNGFRGPRENAPRLDTTQYYRRCTI
RGNIDFIFGGANAVFDSCRIEPWHHKTGTCYITAPCTPAGKPGYLFVDCTVAGNCAPGSV
YLGRPWRADAACYWLDCSLSEEVCVSGWDNWHDPENEKTARFGEYGSTGPGSAPARAFGS
VDRSAEADAQRAMLARLRAEFGLV

Enzyme Prediction     

No EC number prediction in MGYG000003073_01161.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	9	298	4.3e-67	0.9201388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	5.51e-49	18	291	93	378	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	1.58e-39	10	292	3	266	Pectinesterase.
PLN02708	PLN02708	2.37e-36	11	293	245	518	Probable pectinesterase/pectinesterase inhibitor
PLN02773	PLN02773	2.65e-36	4	296	2	274	pectinesterase
PLN02432	PLN02432	4.45e-35	9	292	13	260	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA44050.1	2.51e-75	9	318	4	308
ATP00222.1	2.51e-75	9	318	4	308
QIX89293.1	2.28e-74	9	293	17	303
ANU50094.1	2.57e-73	9	293	17	303
QQR01004.1	2.57e-73	9	293	17	303

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	1.57e-24	10	292	6	269	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	2.03e-22	9	293	9	274	Pectinmethylesterase from Carrot [Daucus carota]
2NSP_A	1.20e-17	19	312	18	326	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
5C1C_A	1.09e-15	17	292	17	266	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	5.09e-15	17	292	17	266	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L7Q7	3.64e-30	19	292	301	566	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2
Q9FM79	2.00e-29	6	292	79	346	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q8GXA1	1.12e-27	4	292	253	523	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q9LXD9	1.41e-27	6	292	238	515	Probable pectinesterase/pectinesterase inhibitor 51 OS=Arabidopsis thaliana OX=3702 GN=PME51 PE=2 SV=1
O81320	2.63e-26	5	292	161	428	Putative pectinesterase/pectinesterase inhibitor 38 OS=Arabidopsis thaliana OX=3702 GN=PME38 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003073_01161.