CAZyme Information: MGYG000003076_00267

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter
• CAZyme ID: MGYG000003076_00267
• CAZy Family: GH37
• CAZyme Description: Cytoplasmic trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
509		58708.79	6.8983

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003076	2833891	MAG	Spain	Europe

• Gene Location: Start: 4738; End: 6267 Strand: +

Full Sequence      

MKTLLIGIFTALLSLIAAAQPQDAVHPDWQREIPRVIYPDKEMVELYEKTWAIAADRVRK
GPEGLPASPYLDENCYDDQIWIWDACFMVMFSKYAPAVYPGKQTLDNLYLPLHENVVSPL
RIHLRDNPPLFAWIEHDNYVFTGDKEHVKYVLEDKKFLQRHFDYFNELSYGDRQPAISPN
PIFKEVVKDEKGNIIGHTWTGGASGMDNTVRGRDAGGYRNILWIDAISQQALSALYIGRL
CERYGLKSEKKHWMKQYKALKQLINEKYWDEQDGFYYDIHKETGEPCRIKTPASFWPMLA
EIPGKAQAARMVKYLENADFMGGKYPWNSLSRDDKDYNGKTGDYWRGGVWLPMVYMGTKA
LEKYGYYELADKLAENVIHQQLRTYHAVTPHTIWECYNPSADEPSTEVGRRARPDFCGWS
ALGPISLFIENVLGFREVDALQKEVNWNLKEKNGTHGLQNLKFGEVITDIVYHADTKKIE
VKSNKPYTLTVNGKKHKISSGNSFIETNF

Enzyme Prediction     

No EC number prediction in MGYG000003076_00267.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	186	420	1e-20	0.4684317718940937

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	3.57e-15	235	399	589	758	alpha-glucosidase; Provisional
pfam01204	Trehalase	8.55e-14	237	376	318	454	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
COG3408	GDB1	1.45e-13	126	434	339	609	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam03200	Glyco_hydro_63	4.34e-13	158	422	195	487	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
COG1626	TreA	1.13e-11	178	376	310	498	Neutral trehalase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWO96172.1	6.96e-216	9	505	10	510
QWP70936.1	6.96e-216	9	505	10	510
QWO91044.1	6.96e-216	9	505	10	510
QWO93599.1	6.96e-216	9	505	10	510
QWO86291.1	6.96e-216	9	505	10	510

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WVA_A	3.71e-09	269	378	277	383	Crystalstructure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVA_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVB_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVB_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVC_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8],4WVC_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8]
2Z07_A	2.02e-08	269	378	277	383	Crystalstructure of uncharacterized conserved protein from Thermus thermophilus HB8 [Thermus thermophilus],2Z07_B Crystal structure of uncharacterized conserved protein from Thermus thermophilus HB8 [Thermus thermophilus]
3W7S_A	1.09e-06	224	421	551	746	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	1.09e-06	224	421	551	746	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
6XUX_A	1.15e-06	224	421	100	295	ChainA, Nanobody,Glucosidase YgjK,Glucosidase YgjK,Nanobody [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94250	5.70e-31	30	492	3	451	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2
P42592	6.02e-06	224	421	574	769	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
P53008	8.09e-06	158	434	548	831	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000296	0.999010	0.000226	0.000156	0.000152	0.000146

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003076_00267.