CAZyme Information: MGYG000003076_00427

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter
• CAZyme ID: MGYG000003076_00427
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
638		71361.14	6.218

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003076	2833891	MAG	Spain	Europe

• Gene Location: Start: 4266; End: 6182 Strand: -

Full Sequence      

MKHEKSTFFPAQIGLGCTWNKQLIREIGKVTGEEARILGYTNVYSPILDLARDPRWGRTV
ETYGEDPYLVGELGRQQVLGIQEKRVVSTPKHFAIYGIPAGGRDCECRTDPHASPQELHE
LHLEPFRIAFQEAGALGTMCSHNDYNGTPVSGSYYLLTEVLRQQWGFKGYVVSDSWSVGK
LKNSYHVVGTDEEAVAAELNAGLNVRTLFQFPEKYIGVLRRAIKQGLVTEEMLDQRVKEV
LYVKFWLGLFDEPYVKHPGRADKVVNCEEHRNLALRAGRESLVLLKNEGNLLPLSKSVKK
VAVIGPLADNRGAMLCRYGSHNPRVITGLEGIKNYLGEEGTVLYAKGCNVRDKHFPESDV
MFFPMSEKEQEEINEAAEIAKQAEVAVIFVGDDSRTIGESRGRVNLNFSGRQQELIRAVE
ATGTPVVLVLFNGRPVTMNWEVKNIPAIIEAWYPGEFSGQVVAEALWGEFNPGGKLSVTF
PKSVGQIPWAFPFKPHATGKGFARVDGSLFPFGYGLSYTTFEISHLTLSTDTLPEGEELE
VSCRVKNTGICKGDEVVQLYLNDEVSSISRYERELCGFERITLEPGEEKTVTFRIGPRAY
GLYNAENRFVTEPGRFTVYVGNSSENLELKSAFWVKKF

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	5	205	1.1e-64	0.8657407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	3	624	114	754	beta-glucosidase BglX.
PLN03080	PLN03080	5.81e-86	6	622	111	770	Probable beta-xylosidase; Provisional
COG1472	BglX	3.32e-85	4	350	78	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	7.04e-74	282	518	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	3.05e-60	7	241	86	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL39935.1	3.13e-259	3	636	168	800
QRM99630.1	6.29e-259	3	636	168	800
QRQ47313.1	1.11e-258	3	636	154	786
QIU93424.1	1.31e-258	3	636	169	801
QUT31652.1	2.54e-258	3	636	168	800

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	6.44e-137	3	637	94	752	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	3.57e-136	3	637	94	752	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
6R5I_A	3.97e-127	3	631	82	729	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	2.19e-126	3	631	82	729	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
5Z87_A	2.21e-126	4	628	138	778	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P33363	3.33e-138	3	628	114	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	8.03e-136	3	628	114	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH0	9.87e-136	3	631	84	717	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	1.07e-113	6	637	138	756	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
P14002	6.47e-94	6	632	67	665	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003076_00427.