CAZyme Information: MGYG000003076_01720

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter
• CAZyme ID: MGYG000003076_01720
• CAZy Family: CBM57
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
407		46156.12	5.2261

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003076	2833891	MAG	Spain	Europe

• Gene Location: Start: 20; End: 1243 Strand: +

Full Sequence      

MLLGFNLYNGWYGGSLSGFEEKLEELHREFPHKPLLITEYGADVDTRIHSFSPMRFDFSC
EFGSIYHEYYLPEVLKRDYIVGAMVWNLNDFYSEARRNAMPHVNNKGLVSTDRERKDGYY
LYQAYLKETPVLHIASKSWKNRAGASRDGKSCTQPLKVYTNADKVEVFLNGKSLGVYPVS
DKVVSVDIPFVNGENVVDAVIEKEGREYRDQYVCNFQCVNVKNGFTEVNVLLGAQRYFED
RTAELCWIPEQAYEKGSWGYMGGEVAPNKTRYGSLPASDTDILGTDQDPIFQTQRVGIEA
FKADVPDGVYAVYLYWTELTSENKREALVYNLGNDVVKEKYANRVFSVDINGVSVAGQMN
IAEEYGSERAVIKKYIVPVSQGKGLVVRFGAVESVPILNAIRIVKEY

Enzyme Prediction     

No EC number prediction in MGYG000003076_01720.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM57	233	401	3.3e-25	0.9523809523809523

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	2.88e-13	6	116	470	582	beta-D-glucuronidase; Provisional
pfam11721	Malectin	2.40e-09	247	401	20	164	Di-glucose binding within endoplasmic reticulum. Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognizes and binds Glc2-N-glycan. It carries a signal peptide from residues 1-26, a C-terminal transmembrane helix from residues 255-274, and a highly conserved central part of approximately 190 residues followed by an acidic, glutamate-rich region. Carbohydrate-binding is mediated by the four aromatic residues, Y67, Y89, Y116, and F117 and the aspartate at D186. NMR-based ligand-screening studies has shown binding of the protein to maltose and related oligosaccharides, on the basis of which the protein has been designated "malectin", and its endogenous ligand is found to be Glc2-high-mannose N-glycan.
pfam16355	DUF4982	6.08e-08	155	207	5	58	Domain of unknown function (DUF4982). This family is found in the C-terminal of uncharacterized proteins and beta-galactosidases around 680 residues in length from various Bacteroides species. The function of this protein is unknown.
pfam02836	Glyco_hydro_2_C	0.001	6	125	175	296	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT71935.1	2.89e-296	1	407	481	887
QNL39157.1	2.35e-295	1	407	481	887
QUR46284.1	8.53e-286	1	407	481	887
QRN00279.1	8.53e-286	1	407	481	887
CBK66217.1	9.77e-286	1	407	485	891

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5UJ6_A	4.27e-82	2	407	481	878	CrystalStructure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],5UJ6_B Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],6NZG_A Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis],6NZG_B Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis]
6D50_A	4.81e-82	2	407	489	886	Bacteroidesuniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii],6D50_B Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii]
6D8G_A	4.81e-82	2	407	489	886	D341AD367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii],6D8G_B D341A D367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii]
6ED1_A	2.79e-67	4	405	477	877	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]
6MVH_A	8.54e-32	2	211	453	651	Crystalstructure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis],6MVH_B Crystal structure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis],6MVH_C Crystal structure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis],6MVH_D Crystal structure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ7	1.17e-22	6	224	484	726	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P05804	9.44e-08	2	123	462	585	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2
A7LXS9	1.09e-07	2	176	518	697	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	4.32e-06	82	175	574	665	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003076_01720.