CAZyme Information: MGYG000003076_01721

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter
• CAZyme ID: MGYG000003076_01721
• CAZy Family: GH50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
470		53586.38	7.5199

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003076	2833891	MAG	Spain	Europe

• Gene Location: Start: 1247; End: 2659 Strand: +

Full Sequence      

MKNSIVILFLLLLSQLGYGQGRTFKVTARPWVKGQKDLPWKEYDTRTIAQLDGFKATDKV
HVNEYGSDLDAPKHRATGFFRVERIGNRWWMIDPDGYRHLQKVVVGVRLGTSERNKQAML
DKFGTEEKWIEGTAQLIHSLGFSGAGSWSNEEAIASYNASHKEVLTRSIILNLMSGYGKK
RGGTYQLPGNTGYPNQCIFVFDPEFETYCDEMAQKLVANKMDKNIIGYFSDNELPFGPKN
LEGYLTLQNPGDPGRVYAESWLKKQGITLQQITDEHREEFAGVVAERYYKVVSEAIRKYD
PNHLYLGSRLHGKPKFIRQIVEAAGRYCDVVAINYYGAWTPSEKTMKHWGEWAQKPFIIT
EFYTKGMDSGLANTTGAGFTVQTQQERGYAYQHFVLGLLESGNCVGWHWFRYQDNDPTAK
GADPSNLDSNKGLIDNEYNLYKPLADAMKELNINAYRLADWFDQQSNNNQ

Enzyme Prediction     

No EC number prediction in MGYG000003076_01721.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH50	116	456	5.5e-84	0.552833078101072

CDD Domains     

MGYG000003076_01721 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT71934.1	0.0	1	470	1	470
QNL39156.1	0.0	1	469	1	469
SCV06348.1	0.0	1	470	2	471
ALJ46941.1	0.0	1	470	1	470
QRQ59048.1	0.0	1	470	1	470

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T3B_A	1.42e-90	37	464	52	481	ChainA, Glycoside Hydrolase [Phocaeicola plebeius],5T3B_B Chain B, Glycoside Hydrolase [Phocaeicola plebeius]
4BQ2_A	6.18e-30	48	456	233	743	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
4BQ4_A	1.50e-29	48	456	233	743	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ4_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
6XJ9_A	9.76e-27	63	456	264	759	Structureof PfGH50B [Pseudoalteromonas fuliginea],6XJ9_B Structure of PfGH50B [Pseudoalteromonas fuliginea]
5Z6P_A	8.08e-21	47	456	248	759	Thecrystal structure of an agarase, AgWH50C [Agarivorans gilvus],5Z6P_B The crystal structure of an agarase, AgWH50C [Agarivorans gilvus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48840	4.82e-25	18	458	435	951	Beta-agarase B OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaB PE=3 SV=1
P48839	8.06e-15	119	456	547	913	Beta-agarase A OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000198	0.999219	0.000150	0.000142	0.000135	0.000127

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003076_01721.