CAZyme Information: MGYG000003077_00881

Basic Information

• Species: CAG-196 sp002102975
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; CAG-196; CAG-196 sp002102975
• CAZyme ID: MGYG000003077_00881
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide core heptosyltransferase RfaQ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328		36902.41	8.5554

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003077	2204918	MAG	Spain	Europe

• Gene Location: Start: 197885; End: 198871 Strand: +

Full Sequence      

MKKKILFINFGGLGDEILFLPTIISTKKEFPDSEITLALEPRSKGILSLTDIIDETLFAD
IKGRNKYIELFNLLRRIWTKKFDIVVSSGSNKFISIFLFMTFIKERIGYNSGRLSEKLLT
HAVRLNKNQYAAKMYHDLVKPLTDNITELPEINIEPRKTEPDTVLIHPGVSLLSVKKGMI
KTIPAEKWAEVVEKLADAGKKVVVAGGPDDKQVIETIERIVPCEKYLNMYGKTRNLKELA
EMISSAEIFLCSDSAPLHVAAALGVKTYVIFGSTDDKKLIPDNGKVIPIKAKCDCPLRPC
LWERRQTTCESLECLNISAEEIVKTVLM

Enzyme Prediction     

No EC number prediction in MGYG000003077_00881.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	73	309	5e-37	0.9422222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	3.35e-50	4	324	1	273	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	2.58e-46	3	289	2	295	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	2.19e-20	73	275	4	213	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	2.67e-15	3	291	6	308	lipopolysaccharide core biosynthesis protein; Provisional
PRK10916	PRK10916	6.68e-04	184	263	193	279	ADP-heptose--LPS heptosyltransferase RfaF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38411.1	1.03e-132	4	327	2	327
BAU12214.1	6.96e-57	4	291	2	301
ARV62225.1	5.39e-52	11	291	9	299
AFZ12385.1	3.06e-51	4	291	2	300
AGY56785.1	3.78e-51	4	289	3	298

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25742	1.45e-13	14	275	5	280	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
Q9R9D5	2.57e-13	14	275	5	280	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
P45042	6.51e-08	115	290	111	306	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999950	0.000084	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003077_00881.