CAZyme Information: MGYG000003077_01565

Basic Information

• Species: CAG-196 sp002102975
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; CAG-196; CAG-196 sp002102975
• CAZyme ID: MGYG000003077_01565
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402		47345.89	8.2691

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003077	2204918	MAG	Spain	Europe

• Gene Location: Start: 162582; End: 163790 Strand: +

Full Sequence      

MMKLLFDCTELSYYDENNGHRAGVFYVALNLFNELKRRGIDITFYCDFRRYYFMKNISEF
KDIPLVTSNSHINRLIARILYKAKDFPYIIKTALTILFRIYDAHFYRKNKKSIAEIEEFD
LYFSPFTPPSKDIQDAQIPKFRMLHDVIPVLETGMAKNAKAWYYKVYNTINDRDFYFANS
ECTRLDVLKYFPFVKTENIKTTLLGVNENFKPCKSDEKKKYVFSLCTLGKRKNIIFAIKN
FITFIEKNKIDDLYLVLGGSNWKVFEAELDRTLKQYDKSKIILTGYVKDEELPKLYSDAL
MFIYPSLYEGFGLPVLEAMKCGCPVITSNTSSLLEVIGNAGIKIDPKSDEELINAYEKFY
YDNFYRELCAERGIIRAREFTWEKCCEEILSFINEKLNQPIK

Enzyme Prediction     

No EC number prediction in MGYG000003077_01565.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	215	362	6.7e-31	0.9125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03809	GT4_MtfB-like	1.10e-63	3	390	1	361	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
cd03801	GT4_PimA-like	6.58e-35	20	394	12	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	4.43e-31	19	399	12	380	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00534	Glycos_transf_1	7.46e-29	218	376	1	158	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
pfam13692	Glyco_trans_1_4	3.97e-24	231	355	1	131	Glycosyl transferases group 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI05171.1	1.92e-75	2	402	4	418
QLI05172.1	7.58e-74	2	399	4	423
SQH71729.1	8.95e-60	4	397	6	441
CBG40230.1	8.95e-60	4	397	6	441
QRI48594.1	3.04e-58	1	388	1	395

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KIH_A	1.91e-09	255	383	275	411	Sucrose-phosphatesynthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_B Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_C Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_D Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_E Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_F Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_G Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_H Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_I Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_J Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_K Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_L Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus]
5I45_A	6.89e-09	265	373	76	188	1.35Angstrom Crystal Structure of C-terminal Domain of Glycosyl Transferase Group 1 Family Protein (LpcC) from Francisella tularensis. [Francisella tularensis subsp. tularensis SCHU S4]
3S28_A	1.44e-08	216	391	569	764	Thecrystal structure of sucrose synthase-1 in complex with a breakdown product of the UDP-glucose [Arabidopsis thaliana],3S28_B The crystal structure of sucrose synthase-1 in complex with a breakdown product of the UDP-glucose [Arabidopsis thaliana],3S28_C The crystal structure of sucrose synthase-1 in complex with a breakdown product of the UDP-glucose [Arabidopsis thaliana],3S28_D The crystal structure of sucrose synthase-1 in complex with a breakdown product of the UDP-glucose [Arabidopsis thaliana],3S28_E The crystal structure of sucrose synthase-1 in complex with a breakdown product of the UDP-glucose [Arabidopsis thaliana],3S28_F The crystal structure of sucrose synthase-1 in complex with a breakdown product of the UDP-glucose [Arabidopsis thaliana],3S28_G The crystal structure of sucrose synthase-1 in complex with a breakdown product of the UDP-glucose [Arabidopsis thaliana],3S28_H The crystal structure of sucrose synthase-1 in complex with a breakdown product of the UDP-glucose [Arabidopsis thaliana],3S29_A The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S29_B The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S29_C The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S29_D The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S29_E The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S29_F The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S29_G The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S29_H The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana]
3S27_A	2.37e-07	216	391	569	764	Thecrystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S27_B The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S27_C The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S27_D The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S27_E The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S27_F The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S27_G The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S27_H The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana]
4RBN_A	8.83e-06	301	391	655	752	Thecrystal structure of Nitrosomonas europaea sucrose synthase: Insights into the evolutionary origin of sucrose metabolism in prokaryotes [Nitrosomonas europaea],4RBN_B The crystal structure of Nitrosomonas europaea sucrose synthase: Insights into the evolutionary origin of sucrose metabolism in prokaryotes [Nitrosomonas europaea],4RBN_C The crystal structure of Nitrosomonas europaea sucrose synthase: Insights into the evolutionary origin of sucrose metabolism in prokaryotes [Nitrosomonas europaea],4RBN_D The crystal structure of Nitrosomonas europaea sucrose synthase: Insights into the evolutionary origin of sucrose metabolism in prokaryotes [Nitrosomonas europaea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7TZT2	3.07e-17	220	401	251	440	Mannosylfructose-phosphate synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=mfpsA PE=1 SV=1
P31922	9.58e-13	186	391	523	758	Sucrose synthase 1 OS=Hordeum vulgare OX=4513 GN=SS1 PE=1 SV=1
Q41608	2.25e-12	186	391	526	761	Sucrose synthase 1 OS=Tulipa gesneriana OX=13306 PE=2 SV=1
P30298	2.25e-12	186	391	524	759	Sucrose synthase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=SUS2 PE=1 SV=2
A6LKE9	2.37e-12	205	396	216	410	Probable sucrose-phosphate synthase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) OX=391009 GN=Tmel_0533 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003077_01565.