CAZyme Information: MGYG000003077_01634

Basic Information

• Species: CAG-196 sp002102975
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; CAG-196; CAG-196 sp002102975
• CAZyme ID: MGYG000003077_01634
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
221		24033.5	10.1133

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003077	2204918	MAG	Spain	Europe

• Gene Location: Start: 37356; End: 38021 Strand: +

Full Sequence      

MFSSMIQNLLSSSGKASAMQRAVQMNNYVNTLNAQWAPVEKQNTAVENQQAKIQSFENVL
KNSTGVKFGDLLTRPVTKVNANIYSAQAETGAEKISTREQIKNIVFRAAKKHGVDEKLVN
ALIKQESGFNPNARSKVGAMGLMQLMPATAKGLGVTNPMDPEQNVEGGVKYLKSMLNKYN
GNVILALAAYNAGPGAVDKYDGVPPYKETQNYVKSILANYL

Enzyme Prediction     

No EC number prediction in MGYG000003077_01634.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	117	220	4.6e-35	0.7703703703703704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	8.44e-55	116	220	1	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	9.37e-54	102	220	7	146	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	4.09e-47	102	220	5	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13403	MLTF-like	9.98e-39	107	220	3	156	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	2.20e-37	105	212	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38062.1	3.05e-78	1	221	1	238
QAV11229.1	1.52e-55	76	220	29	179
QCU17240.1	1.52e-55	85	220	43	179
ARB39308.1	1.52e-55	85	220	43	179
AWM19240.1	3.05e-55	81	220	39	179

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	8.70e-19	105	218	453	587	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	8.85e-19	105	218	482	616	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FCQ_A	2.18e-18	105	218	453	587	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FC4_A	2.18e-18	105	218	454	588	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
5MPQ_A	5.31e-18	102	219	417	551	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	1.40e-54	76	220	29	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	6.41e-43	66	220	1390	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	6.41e-43	66	220	1390	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P27380	5.29e-19	108	193	14	98	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
P0AGC4	1.39e-16	14	218	409	620	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003077_01634.