CAZyme Information: MGYG000003077_01667

Basic Information

• Species: CAG-196 sp002102975
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; CAG-196; CAG-196 sp002102975
• CAZyme ID: MGYG000003077_01667
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
546		64029.24	9.4373

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003077	2204918	MAG	Spain	Europe

• Gene Location: Start: 79401; End: 81041 Strand: +

Full Sequence      

MTKIKNFVLKHPELFTILGLSILFYFIFFHNIWAYALMDVDESRYVSMSKDMFHTKDFLT
LYLNKQFFFEKPPLYFWGECLSFAFWGRVTEFTARFPVALDGMLCCFTVYFLGKRIISRG
YGVVSSLIFATSLEFLILAKFAILDIVVATCIGFSLCFGIFTNFCQEKHKKYCWWLFYIF
SGLAVMAKGIPGFVIPFGSMFFISLYSKNFKEIFKPLYFIPGIILFLLITLPWHIIMLKM
HDPLFFEEYIVKHHIERFIGGNELGREQPFYFYILTLLWGFFPWIFSVLAVFIRKIVKKD
FVFKNVTNIQKFLVYNGIITLFVLVFFSASDTKLVTYILPIYGSLACLGGYIWTRYIEKG
EYSKIINITVYILGGIFILASIIALFTPLYLPAQLNSDIASAKPLCISLLFIAGLASIIF
AKKEKYIGVFFTYVLFMLILSAFGTEKFFEIDYKFGQDDLMRFAEYAKVHNKTLTAYKFD
RKYSLIFYSGQPVEYGLFYNIEDLKNELKEQNNLVIVQYKHMNKDFKNLNYKVIDKGRKY
MLIEKR

Enzyme Prediction     

No EC number prediction in MGYG000003077_01667.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	16	493	1.8e-95	0.8685185185185185

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.95e-39	22	395	17	376	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	1.64e-25	14	421	8	399	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam02366	PMT	5.93e-11	14	235	2	232	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	3.97e-08	71	233	2	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38667.1	2.12e-215	1	544	1	555
ACM19911.1	5.84e-48	28	360	30	352
ABQ27847.1	1.06e-46	23	360	25	352
AIF51770.1	1.40e-46	21	355	13	331
QEM66831.1	3.36e-45	11	493	13	501

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	9.85e-19	37	370	54	381	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67601	3.23e-19	24	358	13	313	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
A4WAM1	2.14e-18	36	348	26	327	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Enterobacter sp. (strain 638) OX=399742 GN=arnT PE=3 SV=1
B4ETL9	1.57e-17	37	348	31	331	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT2 PE=3 SV=1
C5BDQ8	6.47e-17	15	388	8	367	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
B2VBI7	1.52e-16	36	424	26	408	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99) OX=465817 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999561	0.000042	0.000003	0.000000	0.000000	0.000428

TMHMM  Annotations     

start	end
15	37
116	138
143	165
172	186
190	207
214	236
270	292
312	329
334	353
365	384
399	421
426	445